The store will not work correctly when cookies are disabled.
HIF1AN
| Description | Hypoxia-inducible factor 1-alpha inhibitor |
|---|
Gene and Protein Information
| Gene ID | 55662 |
|---|
| Uniprot Accession IDs | D3DR69 Q5W147 Q969Q7 Q9NPV5 |
|---|
| Ensembl ID | ENSP00000299163 |
|---|
| Symbol | FIH1 FIH1 |
|---|
| Sequence | MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 466183 | HIF1AN | hypoxia inducible factor 1 subunit alpha inhibitor | 9598 | VGNC:12343 | OMA, EggNOG |
| Macaque | 710425 | HIF1AN | hypoxia inducible factor 1 alpha subunit inhibitor | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 319594 | Hif1an | hypoxia-inducible factor 1, alpha subunit inhibitor | 10090 | MGI:2442345 | Inparanoid, OMA, EggNOG |
| Rat | 309434 | Hif1an | hypoxia-inducible factor 1, alpha subunit inhibitor | 10116 | RGD:1308281 | Inparanoid, OMA, EggNOG |
| Dog | 609221 | HIF1AN | hypoxia inducible factor 1 subunit alpha inhibitor | 9615 | VGNC:41687 | Inparanoid, OMA, EggNOG |
| Horse | 100070337 | HIF1AN | hypoxia inducible factor 1 subunit alpha inhibitor | 9796 | VGNC:18783 | Inparanoid, OMA, EggNOG |
| Cow | 520864 | HIF1AN | hypoxia inducible factor 1 subunit alpha inhibitor | 9913 | VGNC:29849 | Inparanoid, OMA, EggNOG |
| Pig | 100155854 | HIF1AN | hypoxia inducible factor 1 alpha subunit inhibitor | 9823 | | OMA, EggNOG |
| Opossum | 100010508 | HIF1AN | hypoxia inducible factor 1 alpha subunit inhibitor | 13616 | | Inparanoid, EggNOG |
| Chicken | 428952 | HIF1AN | hypoxia inducible factor 1 alpha subunit inhibitor | 9031 | CGNC:4248 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100564872 | hif1an | hypoxia inducible factor 1 alpha subunit inhibitor | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 394511 | hif1an | hypoxia-inducible factor 1, alpha subunit inhibitor | 8364 | XB-GENE-966944 | Inparanoid, OMA, EggNOG |
| Zebrafish | 373126 | hif1an | hypoxia inducible factor 1 subunit alpha inhibitor | 7955 | ZDB-GENE-030826-19 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
