The store will not work correctly when cookies are disabled.
Protein or Target Summary
Hypoxia-inducible factor 1-alpha inhibitor
| Gene ID | 55662 |
|---|
| uniprot | Q9NWT6 |
|---|
| Gene Name | HIF1AN |
|---|
| Ensernbl ID | ENSP00000299163 |
|---|
| Sequence | MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 55662 | HIF1AN | Hypoxia-inducible factor 1-alpha inhibitor | Q9NWT6 |
| MOUSE | | Hif1an | Uncharacterized protein | Q9D6X3 |
| MOUSE | 319594 | Hif1an | Hypoxia-inducible factor 1-alpha inhibitor | Q8BLR9 |
| RAT | 309434 | Hif1an | Hif1an protein | B0BNG5 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
