JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Heme oxygenase 1

Gene ID	3162
uniprot	P09601
Gene Name	HMOX1
Ensernbl ID	ENSP00000216117
Family	Belongs to the heme oxygenase family.
Sequence	MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	3162	HMOX1	Heme oxygenase 1	P09601
MOUSE		Hmox1	Uncharacterized protein	Q3U5H8
MOUSE		Hmox1	Uncharacterized protein	Q3TVV4
MOUSE	15368	Hmox1	Heme oxygenase	Q3U5U6
MOUSE	15368	Hmox1	Heme oxygenase 1	P14901
RAT	24451	Hmox1	Heme oxygenase 1	P06762

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx