The store will not work correctly when cookies are disabled.
HPGDS
| Description | Hematopoietic prostaglandin D synthase |
|---|
Gene and Protein Information
| Gene ID | 27306 |
|---|
| Uniprot Accession IDs | Q6FHT9 H-PGDS |
|---|
| Ensembl ID | ENSP00000295256 |
|---|
| Symbol | GSTS PGDS PTGDS2 GSTS PGD2 PGDS GSTS1 GSTS1-1 |
|---|
| Family | Belongs to the GST superfamily. Sigma family. |
|---|
| Sequence | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 743219 | HPGDS | hematopoietic prostaglandin D synthase | 9598 | VGNC:48977 | OMA, EggNOG |
| Macaque | 705227 | HPGDS | hematopoietic prostaglandin D synthase | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 54486 | Hpgds | hematopoietic prostaglandin D synthase | 10090 | MGI:1859384 | Inparanoid, OMA, EggNOG |
| Rat | 58962 | Hpgds | hematopoietic prostaglandin D synthase | 10116 | RGD:69251 | Inparanoid, OMA, EggNOG |
| Dog | 478481 | HPGDS | hematopoietic prostaglandin D synthase | 9615 | VGNC:54312 | Inparanoid, OMA, EggNOG |
| Horse | 100053460 | HPGDS | hematopoietic prostaglandin D synthase | 9796 | VGNC:18858 | Inparanoid, OMA, EggNOG |
| Cow | 100139892 | HPGDS | hematopoietic prostaglandin D synthase | 9913 | VGNC:29941 | Inparanoid, OMA |
| Pig | 100623584 | HPGDS | hematopoietic prostaglandin D synthase | 9823 | | OMA, EggNOG |
| Opossum | 100016454 | HPGDS | hematopoietic prostaglandin D synthase | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100078645 | HPGDS | hematopoietic prostaglandin D synthase | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 395863 | HPGDS | hematopoietic prostaglandin D synthase | 9031 | CGNC:49518 | Inparanoid, OMA, EggNOG |
| Xenopus | 448666 | hpgds | hematopoietic prostaglandin D synthase | 8364 | XB-GENE-944778 | Inparanoid, OMA, EggNOG |
| C. elegans | 187817 | gst-11 | Glutathione S-Transferase | 6239 | | Inparanoid, OMA |
| C. elegans | 177883 | gst-3 | Glutathione S-transferase 3 | 6239 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
