The store will not work correctly when cookies are disabled.
Protein or Target Summary
Hematopoietic prostaglandin D synthase
| Gene ID | 27306 |
|---|
| uniprot | O60760 |
|---|
| Gene Name | HPGDS |
|---|
| Ensernbl ID | ENSP00000295256 |
|---|
| Family | Belongs to the GST superfamily. Sigma family. |
|---|
| Sequence | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 27306 | HPGDS | Hematopoietic prostaglandin D synthase | O60760 |
| MOUSE | 54486 | Hpgds | Hematopoietic prostaglandin D synthase | Q9JHF7 |
| RAT | 58962 | Hpgds | Hematopoietic prostaglandin D synthase | O35543 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
