The store will not work correctly when cookies are disabled.
Protein or Target Summary
Beta-crystallin B2
| Gene ID | 1415 |
|---|
| uniprot | P43320 |
|---|
| Gene Name | CRYBB2 |
|---|
| Ensernbl ID | ENSP00000381273 |
|---|
| Family | Belongs to the beta/gamma-crystallin family. |
|---|
| Sequence | MASDHQTQAGKPQSLNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSSDFGAPHPQVQSVRRIRDMQWHQRGAFHPSN Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 1415 | CRYBB2 | Beta-crystallin B2 | P43320 |
| MOUSE | 12961 | Crybb2 | Beta-crystallin B2 | P62696 |
| RAT | 25422 | Crybb2 | Beta-crystallin B2 | P62697 |
| RAT | | CRYBB2 | BetaB2-crystallin | P70635 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
