Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

HDAC1

DescriptionHistone deacetylase 1

Gene and Protein Information

Gene ID3065
Uniprot Accession IDs Q13547 Q92534 HD1
Ensembl ID ENSP00000362649
Symbol RPD3L1 HD1 RPD3 KDAC1 GON-10 RPD3L1
FamilyBelongs to the histone deacetylase family. HD type 1 subfamily.
Sequence
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque708441HDAC1histone deacetylase 19544OMA, EggNOG
Mouse433759Hdac1histone deacetylase 110090MGI:108086Inparanoid, OMA
Rat297893Hdac1histone deacetylase 110116RGD:1309799Inparanoid, OMA
Dog487309HDAC1histone deacetylase 19615VGNC:50625Inparanoid, OMA, EggNOG
Horse100070281HDAC1histone deacetylase 19796VGNC:50592Inparanoid, OMA
Cow404126HDAC1histone deacetylase 19913VGNC:49065Inparanoid, OMA, EggNOG
Opossum100032301HDAC1histone deacetylase 113616OMA, EggNOG
PlatypusHDAC1histone deacetylase 1 [Source:HGNC Symbol;Acc:HGNC:4852]9258OMA, EggNOG
Chicken373961HDAC1histone deacetylase 19031CGNC:2394Inparanoid, OMA
Anole lizard100554517hdac1histone deacetylase 128377Inparanoid, OMA, EggNOG
Xenopus594953hdac1histone deacetylase 18364XB-GENE-479583Inparanoid, OMA
Zebrafish192302hdac1histone deacetylase 17955ZDB-GENE-020419-32Inparanoid, EggNOG
Fruitfly38565HDAC1Histone deacetylase 17227FBgn0015805Inparanoid, OMA
S.cerevisiae855386RPD3histone deacetylase RPD34932S000005274Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    deacetylase    /    Histone deacetylase 1
protein    /    hydrolase    /    reductase    /    Histone deacetylase 1
protein    /    hydrolase    /    nucleic acid binding    /    Histone deacetylase 1
DTO Classes
protein    /    Epigenetic regulator    /    Eraser    /    Histone deacetylase    /    HDAC class I    /    Histone deacetylase 1

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details
Recombinant HDAC1 AntibodyCow,Green Monkey,Human,Mouse,Rat
  • Flow Cytometry
  • IF/ICC
  • IHC
  • WB
Out of Stock
Expand
HDAC1 Mouse mAbCow,Human,Mouse,Rat
  • IF/ICC
  • IHC
  • WB
Out of Stock
Expand

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      1.Wotton, D D, Lo, R S RS, Lee, S S and Massagué, J J. 1999-04-02 A Smad transcriptional corepressor. [PMID:10199400]
      2.Grozinger, C M CM, Hassig, C A CA and Schreiber, S L SL. 1999-04-27 Three proteins define a class of human histone deacetylases related to yeast Hda1p. [PMID:10220385]
      3.Yarden, R I RI and Brody, L C LC. 1999-04-27 BRCA1 interacts with components of the histone deacetylase complex. [PMID:10220405]
      4.Brehm, A A and 6 more authors. 1999-05-04 The E7 oncoprotein associates with Mi2 and histone deacetylase activity to promote cell growth. [PMID:10228159]
      5.Koipally, J J, Renold, A A, Kim, J J and Georgopoulos, K K. 1999-06-01 Repression by Ikaros and Aiolos is mediated through histone deacetylase complexes. [PMID:10357820]
      6.Doetzlhofer, A A and 7 more authors. 1999-08 Histone deacetylase 1 can repress transcription by binding to Sp1. [PMID:10409740]
      7.Zhang, Y Y and 5 more authors. 1999-08-01 Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation. [PMID:10444591]
      8.Ng, H H HH and 8 more authors. 1999-09 MBD2 is a transcriptional repressor belonging to the MeCP1 histone deacetylase complex. [PMID:10471499]
      9.Wade, P A PA and 5 more authors. 1999-09 Mi-2 complex couples DNA methylation to chromatin remodelling and histone deacetylation. [PMID:10471500]
      10.Sparrow, D B DB and 8 more authors. 1999-09-15 MEF-2 function is modified by a novel co-repressor, MITR. [PMID:10487760]