My Cart
You have no items in your shopping cart.
Description | Histone deacetylase 1 |
---|
Gene ID | 3065 |
---|---|
Uniprot Accession IDs | Q13547 Q92534 HD1 |
Ensembl ID | ENSP00000362649 |
Symbol | RPD3L1 HD1 RPD3 KDAC1 GON-10 RPD3L1 |
Family | Belongs to the histone deacetylase family. HD type 1 subfamily. |
Sequence | MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA Show more |
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
---|---|---|---|---|---|---|
Macaque | 708441 | HDAC1 | histone deacetylase 1 | 9544 | OMA, EggNOG | |
Mouse | 433759 | Hdac1 | histone deacetylase 1 | 10090 | MGI:108086 | Inparanoid, OMA |
Rat | 297893 | Hdac1 | histone deacetylase 1 | 10116 | RGD:1309799 | Inparanoid, OMA |
Dog | 487309 | HDAC1 | histone deacetylase 1 | 9615 | VGNC:50625 | Inparanoid, OMA, EggNOG |
Horse | 100070281 | HDAC1 | histone deacetylase 1 | 9796 | VGNC:50592 | Inparanoid, OMA |
Cow | 404126 | HDAC1 | histone deacetylase 1 | 9913 | VGNC:49065 | Inparanoid, OMA, EggNOG |
Opossum | 100032301 | HDAC1 | histone deacetylase 1 | 13616 | OMA, EggNOG | |
Platypus | HDAC1 | histone deacetylase 1 [Source:HGNC Symbol;Acc:HGNC:4852] | 9258 | OMA, EggNOG | ||
Chicken | 373961 | HDAC1 | histone deacetylase 1 | 9031 | CGNC:2394 | Inparanoid, OMA |
Anole lizard | 100554517 | hdac1 | histone deacetylase 1 | 28377 | Inparanoid, OMA, EggNOG | |
Xenopus | 594953 | hdac1 | histone deacetylase 1 | 8364 | XB-GENE-479583 | Inparanoid, OMA |
Zebrafish | 192302 | hdac1 | histone deacetylase 1 | 7955 | ZDB-GENE-020419-32 | Inparanoid, EggNOG |
Fruitfly | 38565 | HDAC1 | Histone deacetylase 1 | 7227 | FBgn0015805 | Inparanoid, OMA |
S.cerevisiae | 855386 | RPD3 | histone deacetylase RPD3 | 4932 | S000005274 | Inparanoid, OMA |
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|---|---|---|---|---|
Recombinant HDAC1 Antibody | Cow,Green Monkey,Human,Mouse,Rat |
Out of Stock
| Expand⌵ | ||
HDAC1 Mouse mAb | Cow,Human,Mouse,Rat |
Out of Stock
| Expand⌵ |
1.Wotton, D D, Lo, R S RS, Lee, S S and Massagué, J J. 1999-04-02 A Smad transcriptional corepressor. [PMID:10199400] |
2.Grozinger, C M CM, Hassig, C A CA and Schreiber, S L SL. 1999-04-27 Three proteins define a class of human histone deacetylases related to yeast Hda1p. [PMID:10220385] |
3.Yarden, R I RI and Brody, L C LC. 1999-04-27 BRCA1 interacts with components of the histone deacetylase complex. [PMID:10220405] |
4.Brehm, A A and 6 more authors. 1999-05-04 The E7 oncoprotein associates with Mi2 and histone deacetylase activity to promote cell growth. [PMID:10228159] |
5.Koipally, J J, Renold, A A, Kim, J J and Georgopoulos, K K. 1999-06-01 Repression by Ikaros and Aiolos is mediated through histone deacetylase complexes. [PMID:10357820] |
6.Doetzlhofer, A A and 7 more authors. 1999-08 Histone deacetylase 1 can repress transcription by binding to Sp1. [PMID:10409740] |
7.Zhang, Y Y and 5 more authors. 1999-08-01 Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation. [PMID:10444591] |
8.Ng, H H HH and 8 more authors. 1999-09 MBD2 is a transcriptional repressor belonging to the MeCP1 histone deacetylase complex. [PMID:10471499] |
9.Wade, P A PA and 5 more authors. 1999-09 Mi-2 complex couples DNA methylation to chromatin remodelling and histone deacetylation. [PMID:10471500] |
10.Sparrow, D B DB and 8 more authors. 1999-09-15 MEF-2 function is modified by a novel co-repressor, MITR. [PMID:10487760] |