Protein or Target Summary
Histone deacetylase 1
| Gene ID | 3065 |
|---|---|
| uniprot | Q13547 |
| Gene Name | HDAC1 |
| Ensernbl ID | ENSP00000362649 |
| Family | Belongs to the histone deacetylase family. HD type 1 subfamily. |
| Sequence | MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA Show more |
Gene and Protein Information
Protein Classes
PANTHER Classes
protein / hydrolase / deacetylase / Histone deacetylase 1
protein / hydrolase / reductase / Histone deacetylase 1
protein / hydrolase / nucleic acid binding / Histone deacetylase 1
protein / hydrolase / deacetylase / Histone deacetylase 1
protein / hydrolase / reductase / Histone deacetylase 1
protein / hydrolase / nucleic acid binding / Histone deacetylase 1
DTO Classes
protein / Epigenetic regulator / Eraser / Histone deacetylase / HDAC class I / Histone deacetylase 1
protein / Epigenetic regulator / Eraser / Histone deacetylase / HDAC class I / Histone deacetylase 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx