Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Serine protease hepsin

Gene ID3249
uniprotP05981
Gene NameHPN
Ensernbl IDENSP00000262626
FamilyBelongs to the peptidase S1 family.
Sequence
MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN3249HPNSerine protease hepsinP05981
MOUSEHpnUncharacterized proteinQ3U0U6
MOUSEHpnSerine protease hepsinF7C9T6
MOUSEHpnSerine protease hepsinE9Q3X9
MOUSEHpnSerine protease hepsinF6W6S4
MOUSEHpnSerine protease hepsinA0A0U1RNM3
MOUSE15451HpnSerine protease hepsinE9Q5P0
MOUSE15451HpnHepsin, isoform CRA_cG3UWE8
MOUSE15451HpnSerine protease hepsinO35453
RATHpnSerine protease hepsinF1LS97
RATHpnHpn proteinQ6GQQ3
RATHpnSerine protease hepsinA0A0G2K7B4
RATHpnSerine protease hepsinA0A0G2KB31
RAT29135HpnSerine protease hepsinQ05511

Protein Classes

PANTHER Classes
protein    /    serine protease    /    Serine protease hepsin
DTO Classes
protein    /    Enzyme    /    Protease    /    Serine protease    /    Serine protease hepsin

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source