The store will not work correctly when cookies are disabled.
FGF2
| Description | Fibroblast growth factor 2 |
|---|
Gene and Protein Information
| Gene ID | 2247 |
|---|
| Uniprot Accession IDs | A4LBB8 O00527 P78443 Q16443 Q5PY50 Q7KZ11 Q7KZ72 Q9UC54 Q9UCS5 Q9UCS6 FGF-2 |
|---|
| Ensembl ID | ENSP00000264498 |
|---|
| Symbol | FGFB BFGF FGFB FGF-2 HBGF-2 |
|---|
| Family | Belongs to the heparin-binding growth factors family. |
|---|
| Sequence | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
|---|
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 2247 | FGF2 | Fibroblast growth factor 2 | P09038 |
| MOUSE | | Fgf2 | Fibroblast growth factor | Q7TPG9 |
| MOUSE | | Fgf2 | FGF2 | Q7TPH0 |
| MOUSE | 14173 | Fgf2 | Fibroblast growth factor | Q541T2 |
| MOUSE | | Fgf2 | Fibroblast growth factor | Q925A3 |
| MOUSE | | Fgf2 | Fibroblast growth factor | Q925A1 |
| MOUSE | | Fgf2 | Fibroblast growth factor | Q925A2 |
| MOUSE | 14173 | Fgf2 | Fibroblast growth factor 2 | P15655 |
| RAT | | Fgf2 | Fibroblast growth factor 2 | A0A2U1 |
| RAT | 54250 | Fgf2 | Fibroblast growth factor 2 | P13109 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
