The store will not work correctly when cookies are disabled.
FGF2
| Description | Fibroblast growth factor 2 |
|---|
Gene and Protein Information
| Gene ID | 2247 |
|---|
| Uniprot Accession IDs | A4LBB8 O00527 P78443 Q16443 Q5PY50 Q7KZ11 Q7KZ72 Q9UC54 Q9UCS5 Q9UCS6 FGF-2 |
|---|
| Ensembl ID | ENSP00000264498 |
|---|
| Symbol | FGFB BFGF FGFB FGF-2 HBGF-2 |
|---|
| Family | Belongs to the heparin-binding growth factors family. |
|---|
| Sequence | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 641462 | FGF2 | fibroblast growth factor 2 | 9598 | | Inparanoid, OMA |
| Macaque | | FGF2 | fibroblast growth factor 2 [Source:HGNC Symbol;Acc:HGNC:3676] | 9544 | | Inparanoid, EggNOG |
| Mouse | 14173 | Fgf2 | fibroblast growth factor 2 | 10090 | MGI:95516 | Inparanoid, EggNOG |
| Rat | 54250 | Fgf2 | fibroblast growth factor 2 | 10116 | RGD:2609 | Inparanoid, EggNOG |
| Dog | 403857 | FGF2 | fibroblast growth factor 2 | 9615 | VGNC:40847 | Inparanoid, OMA, EggNOG |
| Cow | 281161 | FGF2 | fibroblast growth factor 2 | 9913 | | Inparanoid, EggNOG |
| Opossum | 619384 | FGF2 | fibroblast growth factor 2 | 13616 | | Inparanoid, EggNOG |
| Xenopus | 550087 | fgf2 | fibroblast growth factor 2 | 8364 | XB-GENE-487002 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
