JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Low affinity immunoglobulin gamma Fc region receptor II-a

Gene ID	2212
uniprot	P12318
Gene Name	FCGR2A
Ensernbl ID	ENSP00000271450
Sequence	MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	2212	FCGR2A	Low affinity immunoglobulin gamma Fc region receptor II-a	P12318
RAT		Fcgr2a	Fc gamma receptor II beta	M0RCJ0
RAT	116591	Fcgr2a	Fc gamma receptor II beta	M0R4F7

Protein Classes

PANTHER Classes
protein / cell adhesion molecule / Low affinity immunoglobulin gamma Fc region receptor II-a

DTO Classes
protein / Cell adhesion / Low affinity immunoglobulin gamma Fc region receptor II-a

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx