The store will not work correctly when cookies are disabled.
FGF19
| Description | Fibroblast growth factor 19 |
|---|
Gene and Protein Information
| Gene ID | 9965 |
|---|
| Uniprot Accession IDs | FGF-19 |
|---|
| Ensembl ID | ENSP00000294312 |
|---|
| Family | Belongs to the heparin-binding growth factors family. |
|---|
| Sequence | MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 747710 | FGF19 | fibroblast growth factor 19 | 9598 | VGNC:1054 | OMA, EggNOG |
| Mouse | 14170 | Fgf15 | fibroblast growth factor 15 | 10090 | MGI:1096383 | Inparanoid, OMA, EggNOG |
| Rat | 170582 | Fgf19 | fibroblast growth factor 19 | 10116 | RGD:620166 | Inparanoid, OMA, EggNOG |
| Dog | 483681 | FGF19 | fibroblast growth factor 19 | 9615 | VGNC:40846 | Inparanoid, OMA, EggNOG |
| Cow | 521475 | FGF19 | fibroblast growth factor 19 | 9913 | VGNC:28975 | Inparanoid, OMA, EggNOG |
| Pig | 100518950 | FGF19 | fibroblast growth factor 19 | 9823 | | OMA, EggNOG |
| Opossum | 100021575 | FGF19 | fibroblast growth factor 19 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 395394 | FGF19 | fibroblast growth factor 19 | 9031 | CGNC:66203 | Inparanoid, OMA |
| Anole lizard | 100565023 | fgf19 | fibroblast growth factor 19 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100217329 | fgf19 | fibroblast growth factor 19 | 8364 | XB-GENE-486499 | Inparanoid, OMA, EggNOG |
| Zebrafish | 368245 | fgf19 | fibroblast growth factor 19 | 7955 | ZDB-GENE-030729-32 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
