Protein or Target Summary
Peptidyl-prolyl cis-trans isomerase FKBP1A
Gene ID | 2280 |
---|---|
uniprot | P62942 |
Gene Name | FKBP1A |
Ensernbl ID | ENSP00000383003 |
Family | Belongs to the FKBP-type PPIase family. FKBP1 subfamily. |
Sequence | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 2280 | FKBP1A | Peptidyl-prolyl cis-trans isomerase FKBP1A | P62942 |
MOUSE | 14225 | Fkbp1a | FK506 Binding Protein12-T1 | Q1JUQ8 |
MOUSE | 14225 | Fkbp1a | Peptidylprolyl isomerase | Q3UKJ3 |
MOUSE | Fkbp1a | Peptidylprolyl isomerase | F6X9I3 | |
MOUSE | Fkbp1a | FK506 binding protein12 | Q1JUQ6 | |
MOUSE | Fkbp1a | Peptidylprolyl isomerase | Q3UBA0 | |
MOUSE | 14225 | Fkbp1a | FK506 binding protein12-T2 | Q1JUQ7 |
MOUSE | Fkbp1a | Peptidylprolyl isomerase | Q3ULN5 | |
MOUSE | 14225 | Fkbp1a | Peptidyl-prolyl cis-trans isomerase FKBP1A | P26883 |
RAT | 25639 | Fkbp1a | Peptidyl-prolyl cis-trans isomerase FKBP1A | Q62658 |
Protein Classes
PANTHER Classes
protein / calcium-binding protein / Peptidyl-prolyl cis-trans isomerase FKBP1A
protein / isomerase / Peptidyl-prolyl cis-trans isomerase FKBP1A
protein / chaperone / Peptidyl-prolyl cis-trans isomerase FKBP1A
protein / calcium-binding protein / Peptidyl-prolyl cis-trans isomerase FKBP1A
protein / isomerase / Peptidyl-prolyl cis-trans isomerase FKBP1A
protein / chaperone / Peptidyl-prolyl cis-trans isomerase FKBP1A
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx