Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Peptidyl-prolyl cis-trans isomerase FKBP1A

Gene ID2280
uniprotP62942
Gene NameFKBP1A
Ensernbl IDENSP00000383003
FamilyBelongs to the FKBP-type PPIase family. FKBP1 subfamily.
Sequence
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN2280FKBP1APeptidyl-prolyl cis-trans isomerase FKBP1AP62942
MOUSE14225Fkbp1aFK506 Binding Protein12-T1Q1JUQ8
MOUSE14225Fkbp1aPeptidylprolyl isomeraseQ3UKJ3
MOUSEFkbp1aPeptidylprolyl isomeraseF6X9I3
MOUSEFkbp1aFK506 binding protein12Q1JUQ6
MOUSEFkbp1aPeptidylprolyl isomeraseQ3UBA0
MOUSE14225Fkbp1aFK506 binding protein12-T2Q1JUQ7
MOUSEFkbp1aPeptidylprolyl isomeraseQ3ULN5
MOUSE14225Fkbp1aPeptidyl-prolyl cis-trans isomerase FKBP1AP26883
RAT25639Fkbp1aPeptidyl-prolyl cis-trans isomerase FKBP1AQ62658

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    Peptidyl-prolyl cis-trans isomerase FKBP1A
protein    /    isomerase    /    Peptidyl-prolyl cis-trans isomerase FKBP1A
protein    /    chaperone    /    Peptidyl-prolyl cis-trans isomerase FKBP1A
DTO Classes
protein    /    Enzyme    /    Isomerase    /    Peptidyl-prolyl cis-trans isomerase FKBP1A

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source