The store will not work correctly when cookies are disabled.
FKBP1B
| Description | Peptidyl-prolyl cis-trans isomerase FKBP1B |
|---|
Gene and Protein Information
| Gene ID | 2281 |
|---|
| Uniprot Accession IDs | Q13664 Q16645 Q53TM2 Q9BQ40 PPIase FKBP1B |
|---|
| Ensembl ID | ENSP00000370373 |
|---|
| Symbol | FKBP12.6 FKBP1L FKBP9 OTK4 OTK4 FKBP1L PKBP1L PPIase FKBP12.6 |
|---|
| Family | Belongs to the FKBP-type PPIase family. FKBP1 subfamily. |
|---|
| Sequence | MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 741549 | FKBP1B | FK506 binding protein 1B | 9598 | VGNC:10650 | OMA, EggNOG |
| Mouse | 14226 | Fkbp1b | FK506 binding protein 1b | 10090 | MGI:1336205 | Inparanoid, OMA, EggNOG |
| Rat | 58950 | Fkbp1b | FK506 binding protein 1B | 10116 | RGD:61835 | Inparanoid, OMA, EggNOG |
| Dog | 612965 | FKBP1B | FK506 binding protein 1B | 9615 | VGNC:54305 | Inparanoid, OMA, EggNOG |
| Horse | 100071629 | FKBP1B | FK506 binding protein 1B | 9796 | VGNC:51312 | Inparanoid, OMA, EggNOG |
| Cow | 785179 | FKBP1B | FK506 binding protein 1B | 9913 | VGNC:29021 | Inparanoid, OMA, EggNOG |
| Opossum | 100014696 | FKBP1B | FK506 binding protein 1B | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100565880 | fkbp1b | FK506 binding protein 1B | 28377 | | Inparanoid, OMA |
| Zebrafish | 393785 | fkbp1b | FK506 binding protein 1b | 7955 | ZDB-GENE-040426-1785 | Inparanoid, OMA |
| C. elegans | 173160 | fkb-2 | Peptidylprolyl isomerase | 6239 | | Inparanoid, OMA |
| S.cerevisiae | 855587 | FPR1 | peptidylprolyl isomerase FPR1 | 4932 | S000005079 | Inparanoid, OMA |
Protein Classes
PANTHER Classes protein /
isomerase / Peptidyl-prolyl cis-trans isomerase FKBP1B
protein /
calcium-binding protein / Peptidyl-prolyl cis-trans isomerase FKBP1B
protein /
chaperone / Peptidyl-prolyl cis-trans isomerase FKBP1B
DTO Classes protein /
Enzyme /
Isomerase / Peptidyl-prolyl cis-trans isomerase FKBP1B
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
