JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
FLT3LG

FLT3LG

Description	Fms-related tyrosine kinase 3 ligand

Gene and Protein Information

Gene ID	2323
Uniprot Accession IDs	A0AVC2 B9EGH2 Q05C96 Flt3 ligand
Ensembl ID	ENSP00000469613
Symbol	FL FLG3L FLT3L
Sequence	MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	100610021	FLT3LG	fms related tyrosine kinase 3 ligand	9598	VGNC:11105	OMA, EggNOG
Macaque	719239	FLT3LG	fms related tyrosine kinase 3 ligand	9544		Inparanoid, OMA, EggNOG
Mouse	14256	Flt3l	FMS-like tyrosine kinase 3 ligand	10090	MGI:95560	Inparanoid, OMA
Rat	103691134	Flt3lg	fms-related tyrosine kinase 3 ligand	10116	RGD:2322792	Inparanoid, OMA
Dog	442938	FLT3LG	fms related tyrosine kinase 3 ligand	9615	VGNC:40909	Inparanoid, OMA, EggNOG
Cow	282233	FLT3LG	fms related tyrosine kinase 3 ligand	9913	VGNC:29043	Inparanoid, OMA, EggNOG
Pig		FLT3LG	fms related tyrosine kinase 3 ligand [Source:HGNC Symbol;Acc:HGNC:3766]	9823		OMA, EggNOG
Anole lizard	107983337	flt3lg	fms related tyrosine kinase 3 ligand	28377		Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]