FZD6
| Description | Frizzled-6 |
|---|
Gene and Protein Information
| Gene ID | 8323 |
|---|---|
| Uniprot Accession IDs | B4DRN0 Q6N0A5 Q6P9C3 Q8WXR9 Fz-6 |
| Ensembl ID | ENSP00000351605 |
| Symbol | FZ6 FZ-6 HFZ6 NDNC10 |
| Family | Belongs to the G-protein coupled receptor Fz/Smo family. |
| Sequence | MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464327 | FZD6 | frizzled class receptor 6 | 9598 | VGNC:869 | OMA, EggNOG |
| Macaque | 694625 | FZD6 | frizzled class receptor 6 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14368 | Fzd6 | frizzled class receptor 6 | 10090 | MGI:108474 | Inparanoid, OMA, EggNOG |
| Rat | 282581 | Fzd6 | frizzled class receptor 6 | 10116 | RGD:628816 | Inparanoid, OMA, EggNOG |
| Dog | 403610 | FZD6 | frizzled class receptor 6 | 9615 | VGNC:41034 | Inparanoid, OMA, EggNOG |
| Horse | 100056351 | FZD6 | frizzled class receptor 6 | 9796 | VGNC:18174 | Inparanoid, OMA, EggNOG |
| Cow | 445418 | FZD6 | frizzled class receptor 6 | 9913 | VGNC:29170 | Inparanoid, OMA, EggNOG |
| Pig | 100157360 | FZD6 | frizzled class receptor 6 | 9823 | OMA, EggNOG | |
| Opossum | 100023959 | FZD6 | frizzled class receptor 6 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | FZD6 | frizzled class receptor 6 [Source:HGNC Symbol;Acc:HGNC:4044] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100565631 | fzd6 | frizzled class receptor 6 | 28377 | Inparanoid, OMA | |
| Xenopus | 100490861 | fzd6 | frizzled class receptor 6 | 8364 | XB-GENE-478813 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / receptor / protease inhibitor / Frizzled-6
protein / receptor / signaling molecule / Frizzled-6
protein / receptor / G-protein coupled receptor / Frizzled-6
protein / receptor / protease inhibitor / Frizzled-6
protein / receptor / signaling molecule / Frizzled-6
protein / receptor / G-protein coupled receptor / Frizzled-6
DTO Classes
protein / G-protein coupled receptor / Class F frizzled-type / Frizzled receptor / Frizzled-6
protein / G-protein coupled receptor / Class F frizzled-type / Frizzled receptor / Frizzled-6
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|