The store will not work correctly when cookies are disabled.
FUT10
Description | Alpha-(1,3)-fucosyltransferase 10 |
---|
Gene and Protein Information
Gene ID | 84750 |
Uniprot Accession IDs | A8KAC8 Q70GG3 Q8IVI6 Q8IVI7 Q8IVJ3 Q8TE43 Q9BSR3 |
Ensembl ID | ENSP00000332757 |
Symbol | FUCTX |
Family | Belongs to the glycosyltransferase 10 family. |
Sequence | MVRIQRRKLLASCLCVTATVFLLVTLQVMVELGKFERKEFKSSSLQDGHTKMEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTKAFLFYGTDFNIDSLPLPRKAHHDWAVFHEESPKNNYKLFHKPVITLFNYTATFSRHSHLPLTTQYLESIEVLKSLRYLVPLQSKNKLRKRLAPLVYVQSDCDPPSDRDSYVRELMTYIEVDSYGECLRNKDLPQQLKNPASMDADGFYRIIAQYKFILAFENAVCDDYITEKFWRPLKLGVVPVYYGSPSITDWLPSNKSAILVSEFSHPRELASYIRRLDSDDRLYEAYVEWKLKGEISNQRLLTALRERKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSCPEPTVFAFSPLRTPPLSSLREMWISSFEQSKKEAQALRWLVDRNQNFSSQEFWGLVFKD Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 747350 | FUT10 | fucosyltransferase 10 | 9598 | VGNC:12014 | Inparanoid, OMA, EggNOG |
Macaque | 697659 | FUT10 | fucosyltransferase 10 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 171167 | Fut10 | fucosyltransferase 10 | 10090 | MGI:2384748 | Inparanoid, OMA, EggNOG |
Rat | 497619 | Fut10 | fucosyltransferase 10 | 10116 | RGD:1359164 | Inparanoid, OMA |
Dog | 503548 | FUT10 | fucosyltransferase 10 | 9615 | VGNC:41012 | Inparanoid, OMA, EggNOG |
Horse | 100061170 | FUT10 | fucosyltransferase 10 | 9796 | VGNC:18156 | Inparanoid, OMA, EggNOG |
Cow | 360195 | FUT10 | fucosyltransferase 10 | 9913 | VGNC:29148 | Inparanoid, OMA, EggNOG |
Opossum | 100012157 | FUT10 | fucosyltransferase 10 | 13616 | | Inparanoid, OMA, EggNOG |
Chicken | 395073 | FUT10 | fucosyltransferase 10 | 9031 | CGNC:11471 | Inparanoid, OMA |
Anole lizard | 100562842 | fut10 | fucosyltransferase 10 | 28377 | | Inparanoid, OMA |
Xenopus | 444886 | fut10 | fucosyltransferase 10 (alpha (1,3) fucosyltransferase) | 8364 | XB-GENE-976919 | Inparanoid, OMA |
Zebrafish | 497615 | fut10 | fucosyltransferase 10 | 7955 | ZDB-GENE-081022-183 | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|