JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Bis(5'-adenosyl)-triphosphatase

Gene ID	2272
uniprot	P49789
Gene Name	FHIT
Ensernbl ID	ENSP00000417480
Sequence	MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	2272	FHIT	Bis(5'-adenosyl)-triphosphatase	P49789
MOUSE		Fhit	Bis(5'-adenosyl)-triphosphatase	F6SV10
MOUSE	14198	Fhit	Bis(5'-adenosyl)-triphosphatase	E9PZ91
MOUSE		Fhit	Bis(5'-adenosyl)-triphosphatase	E9PVU9
MOUSE		Fhit	Bis(5'-adenosyl)-triphosphatase	E9Q3M6
MOUSE	14198	Fhit	Bis(5'-adenosyl)-triphosphatase	O89106
RAT	60398	Fhit	Bis(5'-adenosyl)-triphosphatase	Q9JIX3

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx