The store will not work correctly when cookies are disabled.
FGF20
| Description | Fibroblast growth factor 20 |
|---|
Gene and Protein Information
| Gene ID | 26281 |
|---|
| Uniprot Accession IDs | B2RPH5 FGF-20 |
|---|
| Ensembl ID | ENSP00000180166 |
|---|
| Symbol | RHDA2 FGF-20 |
|---|
| Family | Belongs to the heparin-binding growth factors family. |
|---|
| Sequence | MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 80857 | Fgf20 | fibroblast growth factor 20 | 10090 | MGI:1891346 | Inparanoid, OMA, EggNOG |
| Rat | 66017 | Fgf20 | fibroblast growth factor 20 | 10116 | RGD:71068 | Inparanoid, OMA, EggNOG |
| Dog | 100855820 | FGF20 | fibroblast growth factor 20 | 9615 | VGNC:51802 | Inparanoid, OMA, EggNOG |
| Horse | 100050037 | FGF20 | fibroblast growth factor 20 | 9796 | VGNC:18015 | Inparanoid, OMA, EggNOG |
| Cow | 539083 | FGF20 | fibroblast growth factor 20 | 9913 | VGNC:28976 | Inparanoid, OMA, EggNOG |
| Pig | 100516301 | FGF20 | fibroblast growth factor 20 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100021885 | FGF20 | fibroblast growth factor 20 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 428779 | FGF20 | fibroblast growth factor 20 | 9031 | CGNC:10236 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
