The store will not work correctly when cookies are disabled.
FKBP5
Description | Peptidyl-prolyl cis-trans isomerase FKBP5 |
---|
Gene and Protein Information
Gene ID | 2289 |
Uniprot Accession IDs | F5H7R1 Q59EB8 Q5TGM6 PPIase FKBP5 |
Ensembl ID | ENSP00000444810 |
Symbol | AIG6 FKBP51 P54 AIG6 FKBP51 FKBP54 PPIase Ptg-10 |
Sequence | MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Mouse | 14229 | Fkbp5 | FK506 binding protein 5 | 10090 | MGI:104670 | Inparanoid, OMA |
Rat | 361810 | Fkbp5 | FK506 binding protein 5 | 10116 | RGD:1309155 | Inparanoid, OMA |
Dog | 481759 | FKBP5 | FK506 binding protein 5 | 9615 | VGNC:40891 | Inparanoid, OMA |
Horse | 100053546 | FKBP5 | FK506 binding protein 5 | 9796 | VGNC:18052 | Inparanoid, OMA |
Cow | 535704 | FKBP5 | FK506 binding protein 5 | 9913 | VGNC:29024 | Inparanoid, OMA |
Pig | 100155423 | FKBP5 | FK506 binding protein 5 | 9823 | | Inparanoid, OMA |
Opossum | 100028545 | FKBP5 | FK506 binding protein 5 | 13616 | | Inparanoid, OMA |
Anole lizard | 100551895 | fkbp5 | FK506 binding protein 5 | 28377 | | Inparanoid, OMA |
Zebrafish | 368924 | fkbp5 | FK506 binding protein 5 | 7955 | ZDB-GENE-030616-630 | Inparanoid, OMA |
C. elegans | 180371 | fkb-6 | Peptidylprolyl isomerase | 6239 | | Inparanoid, OMA |
Protein Classes
PANTHER Classes protein /
calcium-binding protein / Peptidyl-prolyl cis-trans isomerase FKBP5
protein /
isomerase / Peptidyl-prolyl cis-trans isomerase FKBP5
protein /
chaperone / Peptidyl-prolyl cis-trans isomerase FKBP5
DTO Classes protein /
Enzyme /
Isomerase / Peptidyl-prolyl cis-trans isomerase FKBP5
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|