FKBP5

DescriptionPeptidyl-prolyl cis-trans isomerase FKBP5

Gene and Protein Information

Gene ID2289
Uniprot Accession IDs F5H7R1 Q59EB8 Q5TGM6 PPIase FKBP5
Ensembl ID ENSP00000444810
Symbol AIG6 FKBP51 P54 AIG6 FKBP51 FKBP54 PPIase Ptg-10
Sequence
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse14229Fkbp5FK506 binding protein 510090MGI:104670Inparanoid, OMA
Rat361810Fkbp5FK506 binding protein 510116RGD:1309155Inparanoid, OMA
Dog481759FKBP5FK506 binding protein 59615VGNC:40891Inparanoid, OMA
Horse100053546FKBP5FK506 binding protein 59796VGNC:18052Inparanoid, OMA
Cow535704FKBP5FK506 binding protein 59913VGNC:29024Inparanoid, OMA
Pig100155423FKBP5FK506 binding protein 59823Inparanoid, OMA
Opossum100028545FKBP5FK506 binding protein 513616Inparanoid, OMA
Anole lizard100551895fkbp5FK506 binding protein 528377Inparanoid, OMA
Zebrafish368924fkbp5FK506 binding protein 57955ZDB-GENE-030616-630Inparanoid, OMA
C. elegans180371fkb-6Peptidylprolyl isomerase6239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    Peptidyl-prolyl cis-trans isomerase FKBP5
protein    /    isomerase    /    Peptidyl-prolyl cis-trans isomerase FKBP5
protein    /    chaperone    /    Peptidyl-prolyl cis-trans isomerase FKBP5
DTO Classes
protein    /    Enzyme    /    Isomerase    /    Peptidyl-prolyl cis-trans isomerase FKBP5

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source