The store will not work correctly when cookies are disabled.
FLOT2
Gene and Protein Information
Gene ID | 2319 |
Uniprot Accession IDs | Q14254 |
Ensembl ID | ENSP00000378368 |
Symbol | ESA1 M17S1 ESA ECS1 ESA1 ECS-1 M17S1 |
Family | Belongs to the band 7/mec-2 family. Flotillin subfamily. |
Sequence | MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 454537 | FLOT2 | flotillin 2 | 9598 | VGNC:9433 | OMA, EggNOG |
Macaque | 716527 | FLOT2 | flotillin 2 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 14252 | Flot2 | flotillin 2 | 10090 | MGI:103309 | Inparanoid, OMA, EggNOG |
Rat | 83764 | Flot2 | flotillin 2 | 10116 | RGD:70993 | Inparanoid, OMA |
Horse | 100072090 | FLOT2 | flotillin 2 | 9796 | VGNC:18064 | Inparanoid, OMA, EggNOG |
Cow | 615679 | FLOT2 | flotillin 2 | 9913 | VGNC:29037 | Inparanoid, OMA, EggNOG |
Pig | 100518752 | FLOT2 | flotillin 2 | 9823 | | OMA, EggNOG |
Opossum | 100025079 | FLOT2 | flotillin 2 | 13616 | | Inparanoid, OMA, EggNOG |
Anole lizard | 100563055 | flot2 | flotillin 2 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 496443 | flot2 | flotillin 2 | 8364 | XB-GENE-5910825 | Inparanoid, OMA, EggNOG |
Zebrafish | 245698 | flot2a | flotillin 2a | 7955 | ZDB-GENE-020430-3 | Inparanoid, OMA |
Zebrafish | 393612 | flot2b | flotillin 2b | 7955 | ZDB-GENE-040426-1368 | OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|