The store will not work correctly when cookies are disabled.
FGF7
| Description | Fibroblast growth factor 7 |
|---|
Gene and Protein Information
| Gene ID | 2252 |
|---|
| Uniprot Accession IDs | H0YNY5 Q6FGV5 Q96FG5 FGF-7 |
|---|
| Ensembl ID | ENSP00000267843 |
|---|
| Symbol | KGF KGF HBGF-7 |
|---|
| Family | Belongs to the heparin-binding growth factors family. |
|---|
| Sequence | MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 744975 | FGF7 | fibroblast growth factor 7 | 9598 | VGNC:11889 | OMA, EggNOG |
| Macaque | 574345 | FGF7 | fibroblast growth factor 7 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 14178 | Fgf7 | fibroblast growth factor 7 | 10090 | MGI:95521 | Inparanoid, OMA, EggNOG |
| Rat | 29348 | Fgf7 | fibroblast growth factor 7 | 10116 | RGD:61805 | Inparanoid, OMA, EggNOG |
| Dog | 403915 | FGF7 | fibroblast growth factor 7 | 9615 | VGNC:40853 | Inparanoid, OMA, EggNOG |
| Horse | 100033961 | FGF7 | fibroblast growth factor 7 | 9796 | VGNC:18020 | Inparanoid, OMA, EggNOG |
| Cow | 616885 | FGF7 | fibroblast growth factor 7 | 9913 | VGNC:28982 | Inparanoid, OMA, EggNOG |
| Opossum | 100025923 | FGF7 | fibroblast growth factor 7 | 13616 | | Inparanoid, EggNOG |
| Chicken | 415439 | FGF7 | fibroblast growth factor 7 | 9031 | CGNC:66242 | Inparanoid, OMA |
| Anole lizard | 100558897 | fgf7 | fibroblast growth factor 7 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 496833 | fgf7 | fibroblast growth factor 7 | 8364 | XB-GENE-488183 | Inparanoid, OMA, EggNOG |
| Zebrafish | 493181 | fgf7 | fibroblast growth factor 7 | 7955 | ZDB-GENE-080122-1 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
