The store will not work correctly when cookies are disabled.
FGF21
| Description | Fibroblast growth factor 21 |
|---|
Gene and Protein Information
| Gene ID | 26291 |
|---|
| Uniprot Accession IDs | Q8N683 FGF-21 |
|---|
| Ensembl ID | ENSP00000471477 |
|---|
| Family | Belongs to the heparin-binding growth factors family. |
|---|
| Sequence | MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 468948 | FGF21 | fibroblast growth factor 21 | 9598 | VGNC:2406 | OMA, EggNOG |
| Macaque | 718288 | FGF21 | fibroblast growth factor 21 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 56636 | Fgf21 | fibroblast growth factor 21 | 10090 | MGI:1861377 | Inparanoid, OMA, EggNOG |
| Rat | 170580 | Fgf21 | fibroblast growth factor 21 | 10116 | RGD:620175 | Inparanoid, OMA, EggNOG |
| Dog | 484395 | FGF21 | fibroblast growth factor 21 | 9615 | VGNC:40848 | Inparanoid, OMA, EggNOG |
| Horse | 100054542 | FGF21 | fibroblast growth factor 21 | 9796 | VGNC:18016 | Inparanoid, OMA, EggNOG |
| Cow | 785576 | FGF21 | fibroblast growth factor 21 | 9913 | VGNC:28977 | Inparanoid, OMA, EggNOG |
| Pig | 100302504 | FGF21 | fibroblast growth factor 21 | 9823 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100564275 | fgf21 | fibroblast growth factor 21 | 28377 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
