The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 2172 |
|---|
| Uniprot Accession IDs | Q07DR7 Q8TBI3 Q9UGI7 GT |
|---|
| Ensembl ID | ENSP00000377549 |
|---|
| Symbol | ILBP ILLBP ILBP I-15P I-BAP ILBP3 ILLBP I-BABP I-BALB |
|---|
| Family | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
|---|
| Sequence | MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 107974918 | FABP6 | fatty acid binding protein 6 | 9598 | VGNC:6871 | OMA, EggNOG |
| Macaque | 695439 | FABP6 | fatty acid binding protein 6 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 16204 | Fabp6 | fatty acid binding protein 6, ileal (gastrotropin) | 10090 | MGI:96565 | Inparanoid, OMA, EggNOG |
| Rat | 25440 | Fabp6 | fatty acid binding protein 6 | 10116 | RGD:2592 | Inparanoid, OMA, EggNOG |
| Dog | 479309 | FABP6 | fatty acid binding protein 6 | 9615 | VGNC:40562 | Inparanoid, OMA, EggNOG |
| Horse | 100059749 | FABP6 | fatty acid binding protein 6 | 9796 | VGNC:17769 | Inparanoid, OMA, EggNOG |
| Cow | 514650 | FABP6 | fatty acid binding protein 6 | 9913 | VGNC:28698 | Inparanoid, OMA, EggNOG |
| Pig | 397423 | FABP6 | fatty acid binding protein 6 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100025594 | FABP6 | gastrotropin | 13616 | | Inparanoid, EggNOG |
| Chicken | 416154 | FABP6 | fatty acid binding protein 6 | 9031 | CGNC:998 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556796 | fabp6 | fatty acid binding protein 6 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100487630 | fabp6 | fatty acid binding protein 6, ileal | 8364 | XB-GENE-994094 | Inparanoid, OMA, EggNOG |
| Zebrafish | 415166 | fabp6 | fatty acid binding protein 6, ileal (gastrotropin) | 7955 | ZDB-GENE-040625-49 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
