The store will not work correctly when cookies are disabled.
FCGRT
| Description | IgG receptor FcRn large subunit p51 |
|---|
Gene and Protein Information
| Gene ID | 2217 |
|---|
| Uniprot Accession IDs | Q5HYM5 Q9HBV7 Q9NZ19 FcRn |
|---|
| Ensembl ID | ENSP00000221466 |
|---|
| Symbol | FCRN FCRN alpha-chain |
|---|
| Family | Belongs to the immunoglobulin superfamily. |
|---|
| Sequence | MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 456208 | FCGRT | Fc fragment of IgG receptor and transporter | 9598 | VGNC:7558 | Inparanoid, OMA, EggNOG |
| Macaque | 718859 | FCGRT | Fc fragment of IgG receptor and transporter | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 14132 | Fcgrt | Fc receptor, IgG, alpha chain transporter | 10090 | MGI:103017 | Inparanoid, OMA, EggNOG |
| Rat | 29558 | Fcgrt | Fc fragment of IgG receptor and transporter | 10116 | RGD:61811 | Inparanoid, OMA, EggNOG |
| Dog | 476414 | FCGRT | Fc fragment of IgG receptor and transporter | 9615 | VGNC:40803 | Inparanoid, OMA, EggNOG |
| Horse | 100147583 | FCGRT | Fc fragment of IgG receptor and transporter | 9796 | VGNC:17976 | Inparanoid, OMA, EggNOG |
| Cow | 338062 | FCGRT | Fc fragment of IgG receptor and transporter | 9913 | VGNC:28934 | Inparanoid, OMA, EggNOG |
| Pig | 397399 | FCGRT | Fc fragment of IgG receptor and transporter | 9823 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
