The store will not work correctly when cookies are disabled.
Protein or Target Summary
Fatty acid-binding protein 5
| Gene ID | 2171 |
|---|
| uniprot | Q01469 |
|---|
| Gene Name | FABP5 |
|---|
| Ensernbl ID | ENSP00000297258 |
|---|
| Family | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
|---|
| Sequence | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 2171 | FABP5 | Fatty acid-binding protein 5 | Q01469 |
| MOUSE | 16592 | Fabp5 | Fatty acid-binding protein 5 | Q05816 |
| MOUSE | | Fabp5 | Uncharacterized protein | Q3TLH6 |
| MOUSE | 16592 | Fabp5 | Fatty acid binding protein 5, epidermal | Q497I3 |
| RAT | | Fabp5 | Epidermal fatty acid binding protein 5 | Q2XTA4 |
| RAT | 140868 | Fabp5 | Fatty acid-binding protein 5 | P55053 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
