The store will not work correctly when cookies are disabled.
FABP5
| Description | Fatty acid-binding protein 5 |
|---|
Gene and Protein Information
| Gene ID | 2171 |
|---|
| Uniprot Accession IDs | B2R4K0 |
|---|
| Ensembl ID | ENSP00000297258 |
|---|
| Symbol | EFABP KFABP E-FABP PAFABP PA-FABP |
|---|
| Family | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
|---|
| Sequence | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 746909 | FABP5 | fatty acid binding protein 5 | 9598 | VGNC:6678 | OMA, EggNOG |
| Mouse | 16592 | Fabp5 | fatty acid binding protein 5, epidermal | 10090 | MGI:101790 | Inparanoid, OMA, EggNOG |
| Rat | 140868 | Fabp5 | fatty acid binding protein 5 | 10116 | RGD:70997 | Inparanoid, OMA, EggNOG |
| Horse | 100057538 | FABP5 | fatty acid binding protein 5 | 9796 | | Inparanoid, OMA, EggNOG |
| Cow | | FABP5 | fatty acid binding protein 5 [Source:HGNC Symbol;Acc:HGNC:3560] | 9913 | | OMA, EggNOG |
| Pig | 574074 | FABP5 | fatty acid binding protein 5 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | | FABP5 | fatty acid binding protein 5 [Source:HGNC Symbol;Acc:HGNC:3560] | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100075490 | FABP5 | fatty acid binding protein 5 | 9258 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100555334 | LOC100555334 | fatty acid-binding protein, epidermal | 28377 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
