The store will not work correctly when cookies are disabled.
RCE1
| Description | CAAX prenyl protease 2 |
|---|
Gene and Protein Information
| Gene ID | 9986 |
|---|
| Uniprot Accession IDs | Q52LZ9 |
|---|
| Ensembl ID | ENSP00000309163 |
|---|
| Symbol | FACE2 RCE1A RCE1B FACE2 RCE1A RCE1B |
|---|
| Family | Belongs to the peptidase U48 family. |
|---|
| Sequence | MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSELPRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCVLLERAGDSEAPLCS Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 451355 | RCE1 | Ras converting CAAX endopeptidase 1 | 9598 | VGNC:1027 | OMA, EggNOG |
| Macaque | 713224 | RCE1 | Ras converting CAAX endopeptidase 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 19671 | Rce1 | Ras converting CAAX endopeptidase 1 | 10090 | MGI:1336895 | Inparanoid, OMA, EggNOG |
| Rat | 309153 | Rce1 | Ras converting CAAX endopeptidase 1 | 10116 | RGD:1309261 | Inparanoid, OMA, EggNOG |
| Dog | 483705 | RCE1 | Ras converting CAAX endopeptidase 1 | 9615 | | Inparanoid, EggNOG |
| Horse | 100052803 | RCE1 | Ras converting CAAX endopeptidase 1 | 9796 | VGNC:22270 | Inparanoid, OMA, EggNOG |
| Cow | 539539 | RCE1 | Ras converting CAAX endopeptidase 1 | 9913 | VGNC:33828 | Inparanoid, OMA, EggNOG |
| Pig | 100514389 | RCE1 | Ras converting CAAX endopeptidase 1 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100015109 | RCE1 | Ras converting CAAX endopeptidase 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556866 | rce1 | Ras converting CAAX endopeptidase 1 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 549000 | rce1 | Ras converting CAAX endopeptidase 1 | 8364 | XB-GENE-979449 | Inparanoid, OMA, EggNOG |
| Zebrafish | 557720 | rce1a | Ras converting CAAX endopeptidase 1a | 7955 | ZDB-GENE-041008-116 | Inparanoid, OMA, EggNOG |
| C. elegans | 3565253 | fce-2 | CAAX prenyl protease 2 homolog | 6239 | | Inparanoid, OMA, EggNOG |
| Fruitfly | 44002 | Sras | severas | 7227 | FBgn0029121 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 855317 | RCE1 | CAAX prenyl protease | 4932 | S000004887 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
