Protein or Target Summary
CAAX prenyl protease 2
Gene ID | 9986 |
---|---|
uniprot | Q9Y256 |
Gene Name | RCE1 |
Ensernbl ID | ENSP00000309163 |
Family | Belongs to the peptidase U48 family. |
Sequence | MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSELPRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCVLLERAGDSEAPLCS Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 9986 | RCE1 | CAAX prenyl protease 2 | Q9Y256 |
MOUSE | 19671 | Rce1 | CAAX prenyl protease 2 | P57791 |
MOUSE | Rce1 | CAAX prenyl protease 2 | A0A286YD70 | |
MOUSE | Rce1 | CAAX prenyl protease 2 | A0A286YCK9 | |
MOUSE | Rce1 | CAAX prenyl protease 2 | A0A286YCQ7 | |
MOUSE | Rce1 | CAAX prenyl protease 2 | A0A286YDK5 | |
MOUSE | 19671 | Rce1 | CAAX prenyl protease 2 | Q99KQ3 |
RAT | 309153 | Rce1 | Rce1 protein | Q5M955 |
RAT | 309153 | Rce1 | CAAX prenyl protease 2 | G3V8J7 |
RAT | 309153 | Rce1 | CAAX prenyl protease 2 | B0BMW8 |
Protein Classes
PANTHER Classes
protein / metalloprotease / CAAX prenyl protease 2
protein / protease / CAAX prenyl protease 2
protein / hydrolase / CAAX prenyl protease 2
protein / metalloprotease / CAAX prenyl protease 2
protein / protease / CAAX prenyl protease 2
protein / hydrolase / CAAX prenyl protease 2
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx