Protein or Target Summary
Cyclin-dependent kinase 7
| Gene ID | 1022 |
|---|---|
| uniprot | P50613 |
| Gene Name | CDK7 |
| Ensernbl ID | ENSP00000256443 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 1022 | CDK7 | Cyclin-dependent kinase 7 | P50613 |
| MOUSE | 12572 | Cdk7 | Cyclin-dependent kinase 7 | Q03147 |
| MOUSE | Cdk7 | Uncharacterized protein | Q3UJT4 | |
| MOUSE | Cdk7 | Uncharacterized protein | Q8CAC4 | |
| MOUSE | Cdk7 | Cyclin-dependent kinase 7 | A0A286YDC0 | |
| MOUSE | 12572 | Cdk7 | Cyclin-dependent kinase 7 (Homolog of Xenopus MO15 cdk-activating kinase) | Q3THG5 |
| RAT | Cdk7 | Cyclin-dependent kinase 7 | P51952 | |
| RAT | Cdk7 | Cyclin-dependent kinase 7 | F1LQC8 |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 7
protein / protein kinase / Cyclin-dependent kinase 7
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 7
protein / transferase / Cyclin-dependent kinase 7
protein / kinase / Cyclin-dependent kinase 7
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 7
protein / protein kinase / Cyclin-dependent kinase 7
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 7
protein / transferase / Cyclin-dependent kinase 7
protein / kinase / Cyclin-dependent kinase 7
DTO Classes
protein / Kinase / Protein kinase / CMGC group / CDK family / CDK7 subfamily / Cyclin-dependent kinase 7
protein / Kinase / Protein kinase / CMGC group / CDK family / CDK7 subfamily / Cyclin-dependent kinase 7
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx