The store will not work correctly when cookies are disabled.
Protein or Target Summary
Low affinity immunoglobulin epsilon Fc receptor
Target ID | 6646 |
Gene ID | 2208 |
uniprot | P06734 |
Gene Name | FCER2 |
Ensernbl ID | ENSP00000264072 |
Sequence | MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 2208 | FCER2 | Low affinity immunoglobulin epsilon Fc receptor | P06734 |
MOUSE | 14128 | Fcer2 | Low affinity immunoglobulin epsilon Fc receptor | P20693 |
RAT | 171075 | Fcer2 | Fc fragment of IgE receptor II | Q6AZ45 |
RAT | 171075 | Fcer2 | CD23 protein | Q63097 |
RAT | 171075 | Fcer2 | Fc fragment of IgE receptor II | G3V638 |
Protein Classes
protein / Receptor / Cytokine receptor / Immunoglobulin receptor superfamily / Low affinity immunoglobulin epsilon Fc receptor
Pathway
Data Source | Name | Explore in Pharos | Explore in Source |
---|