The store will not work correctly when cookies are disabled.
FCER1G
| Description | High affinity immunoglobulin epsilon receptor subunit gamma |
|---|
Gene and Protein Information
| Gene ID | 2207 |
|---|
| Uniprot Accession IDs | Q5VTW4 |
|---|
| Ensembl ID | ENSP00000289902 |
|---|
| Symbol | FCRG |
|---|
| Family | Belongs to the CD3Z/FCER1G family. |
|---|
| Sequence | MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 100612300 | FCER1G | Fc fragment of IgE receptor Ig | 9598 | VGNC:6818 | OMA, EggNOG |
| Macaque | 720291 | FCER1G | Fc fragment of IgE receptor Ig | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 14127 | Fcer1g | Fc receptor, IgE, high affinity I, gamma polypeptide | 10090 | MGI:95496 | Inparanoid, OMA, EggNOG |
| Rat | 25441 | Fcer1g | Fc fragment of IgE receptor Ig | 10116 | RGD:2599 | Inparanoid, OMA, EggNOG |
| Dog | 403798 | FCER1G | Fc fragment of IgE receptor Ig | 9615 | VGNC:40802 | Inparanoid, OMA, EggNOG |
| Horse | 100034137 | FCER1G | Fc fragment of IgE receptor Ig | 9796 | VGNC:17973 | OMA, EggNOG |
| Cow | 282226 | FCER1G | Fc fragment of IgE receptor Ig | 9913 | VGNC:28931 | Inparanoid, OMA, EggNOG |
| Pig | 397406 | FCER1G | Fc fragment of IgE receptor Ig | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | | FCER1G | Fc fragment of IgE receptor Ig [Source:HGNC Symbol;Acc:HGNC:3611] | 13616 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
