The store will not work correctly when cookies are disabled.
Protein or Target Summary
High affinity immunoglobulin epsilon receptor subunit gamma
| Target ID | 6649 |
|---|
| Gene ID | 2207 |
|---|
| uniprot | P30273 |
|---|
| Gene Name | FCER1G |
|---|
| Ensernbl ID | ENSP00000289902 |
|---|
| Family | Belongs to the CD3Z/FCER1G family. |
|---|
| Sequence | MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 2207 | FCER1G | High affinity immunoglobulin epsilon receptor subunit gamma | P30273 |
| MOUSE | | Fcer1g | High affinity immunoglobulin epsilon receptor subunit gamma | A0A0A6YVS1 |
| MOUSE | 14127 | Fcer1g | High affinity immunoglobulin epsilon receptor subunit gamma | P20491 |
| RAT | 25441 | Fcer1g | High affinity immunoglobulin epsilon receptor subunit gamma | P20411 |
| RAT | 25441 | Fcer1g | Fcer1g protein | B1H251 |
Pathway
| Data Source | Name | Explore in Pharos | Explore in Source |
|---|
