The store will not work correctly when cookies are disabled.
HES1
| Description | Transcription factor HES-1 |
|---|
Gene and Protein Information
| Gene ID | 3280 |
|---|
| Uniprot Accession IDs | Q6FHB2 |
|---|
| Ensembl ID | ENSP00000232424 |
|---|
| Symbol | BHLHB39 HL HRY HHL HRY HES-1 bHLHb39 |
|---|
| Sequence | MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 15205 | Hes1 | hes family bHLH transcription factor 1 | 10090 | MGI:104853 | Inparanoid, OMA |
| Rat | 29577 | Hes1 | hes family bHLH transcription factor 1 | 10116 | RGD:62081 | Inparanoid, OMA |
| Cow | 539547 | HES1 | hes family bHLH transcription factor 1 | 9913 | VGNC:29818 | Inparanoid, OMA |
| Opossum | 100011897 | HES1 | hes family bHLH transcription factor 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | HES1 | hes family bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:5192] | 9258 | | OMA, EggNOG |
| Xenopus | 496617 | hes1 | hes family bHLH transcription factor 1 | 8364 | XB-GENE-487995 | Inparanoid, OMA |
| Zebrafish | 30288 | her6 | hairy-related 6 | 7955 | ZDB-GENE-980526-144 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
