The store will not work correctly when cookies are disabled.
FGF10
| Description | Fibroblast growth factor 10 |
|---|
Gene and Protein Information
| Gene ID | 2255 |
|---|
| Uniprot Accession IDs | C7FDY0 Q6FHR3 Q6FHT6 Q96P59 FGF-10 |
|---|
| Ensembl ID | ENSP00000264664 |
|---|
| Family | Belongs to the heparin-binding growth factors family. |
|---|
| Sequence | MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 14165 | Fgf10 | fibroblast growth factor 10 | 10090 | MGI:1099809 | Inparanoid, OMA, EggNOG |
| Rat | 25443 | Fgf10 | fibroblast growth factor 10 | 10116 | RGD:2606 | Inparanoid, OMA, EggNOG |
| Dog | 612454 | FGF10 | fibroblast growth factor 10 | 9615 | VGNC:40839 | Inparanoid, OMA, EggNOG |
| Horse | 100052655 | FGF10 | fibroblast growth factor 10 | 9796 | VGNC:18009 | Inparanoid, OMA, EggNOG |
| Pig | 100525086 | FGF10 | fibroblast growth factor 10 | 9823 | | OMA, EggNOG |
| Opossum | | FGF10 | fibroblast growth factor 10 [Source:HGNC Symbol;Acc:HGNC:3666] | 13616 | | Inparanoid, OMA, EggNOG |
| Xenopus | 548923 | fgf10 | fibroblast growth factor 10 | 8364 | XB-GENE-485044 | Inparanoid, OMA, EggNOG |
| Zebrafish | 359830 | fgf10a | fibroblast growth factor 10a | 7955 | ZDB-GENE-030715-1 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
