FFAR3

DescriptionFree fatty acid receptor 3

Gene and Protein Information

Gene ID2865
Uniprot Accession IDs B2RWM8 Q14CM7
Ensembl ID ENSP00000328230
Symbol GPR41 FFA3R GPR41 GPR42
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp455946LOC455946free fatty acid receptor 39598OMA, EggNOG
Mouse233080Ffar3free fatty acid receptor 310090MGI:2685324OMA, EggNOG
Rat365228Ffar3free fatty acid receptor 310116RGD:1311035OMA, EggNOG
Horse102150446FFAR3free fatty acid receptor 39796OMA, EggNOG
Cow527517FFAR3free fatty acid receptor 39913OMA, EggNOG
Pig100517655FFAR3free fatty acid receptor 39823OMA, EggNOG
Opossum100015775FFAR3free fatty acid receptor 313616OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Free fatty acid receptor    /    Free fatty acid receptor 3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source