The store will not work correctly when cookies are disabled.
Protein or Target Summary
Heat shock protein beta-1
| Gene ID | 3315 |
|---|
| uniprot | P04792 |
|---|
| Gene Name | HSPB1 |
|---|
| Ensernbl ID | ENSP00000248553 |
|---|
| Family | Belongs to the small heat shock protein (HSP20) family. |
|---|
| Sequence | MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 3315 | HSPB1 | Heat shock protein beta-1 | P04792 |
| MOUSE | | Hspb1 | Truncated hsp25 | Q9Z2L3 |
| MOUSE | | Hspb1 | Heat shock protein beta-1 | D3YZ06 |
| MOUSE | | Hspb1 | Truncated hsp25 | Q9Z2L2 |
| MOUSE | 15507 | Hspb1 | Hspb1 protein | Q545F4 |
| MOUSE | 15507 | Hspb1 | Heat shock protein beta-1 | P14602 |
| RAT | 24471 | Hspb1 | Heat shock 27kDa protein 1 | G3V913 |
| RAT | | Hspb1 | Heat shock protein beta-1 | P42930 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
