The store will not work correctly when cookies are disabled.
EIF6
| Description | Eukaryotic translation initiation factor 6 |
|---|
Gene and Protein Information
| Gene ID | 3692 |
|---|
| Uniprot Accession IDs | B7ZBG9 Q6IBN8 Q96TD5 eIF-6 |
|---|
| Ensembl ID | ENSP00000363574 |
|---|
| Symbol | EIF3A ITGB4BP CAB EIF3A eIF-6 p27BBP ITGB4BP b(2)gcn p27(BBP) |
|---|
| Family | Belongs to the eIF-6 family. |
|---|
| Sequence | MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 458200 | EIF6 | eukaryotic translation initiation factor 6 | 9598 | VGNC:6100 | OMA, EggNOG |
| Macaque | 709602 | EIF6 | eukaryotic translation initiation factor 6 | 9544 | | OMA, EggNOG |
| Mouse | 16418 | Eif6 | eukaryotic translation initiation factor 6 | 10090 | MGI:1196288 | Inparanoid, OMA, EggNOG |
| Rat | 305506 | Eif6 | eukaryotic translation initiation factor 6 | 10116 | RGD:1305373 | Inparanoid, OMA, EggNOG |
| Dog | 477210 | EIF6 | eukaryotic translation initiation factor 6 | 9615 | VGNC:54648 | Inparanoid, OMA, EggNOG |
| Horse | 100054650 | EIF6 | eukaryotic translation initiation factor 6 | 9796 | | Inparanoid, OMA, EggNOG |
| Cow | 286811 | EIF6 | eukaryotic translation initiation factor 6 | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | 100627301 | EIF6 | eukaryotic translation initiation factor 6 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100017773 | EIF6 | eukaryotic translation initiation factor 6 | 13616 | | OMA, EggNOG |
| Platypus | 100088029 | EIF6 | eukaryotic translation initiation factor 6 | 9258 | | OMA, EggNOG |
| Anole lizard | 100562749 | eif6 | eukaryotic translation initiation factor 6 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 448711 | eif6 | eukaryotic translation initiation factor 6 | 8364 | XB-GENE-868337 | Inparanoid, EggNOG |
| Zebrafish | 386850 | eif6 | eukaryotic translation initiation factor 6 | 7955 | ZDB-GENE-031118-110 | Inparanoid, OMA, EggNOG |
| C. elegans | 173169 | eif-6 | Eukaryotic translation initiation factor 6 | 6239 | | Inparanoid, OMA, EggNOG |
| Fruitfly | 37776 | eIF6 | CG17611 gene product from transcript CG17611-RA | 7227 | FBgn0034915 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 856126 | TIF6 | translation initiation factor 6 | 4932 | S000006220 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
