Protein or Target Summary
Interleukin-10 receptor subunit beta
| Gene ID | 3588 |
|---|---|
| uniprot | Q08334 |
| Gene Name | IL10RB |
| Ensernbl ID | ENSP00000290200 |
| Family | Belongs to the type II cytokine receptor family. |
| Sequence | MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 3588 | IL10RB | Interleukin-10 receptor subunit beta | Q08334 |
| MOUSE | Il10rb | Interleukin-10 receptor subunit beta | E9Q294 | |
| MOUSE | Il10rb | Interleukin-10 receptor subunit beta | E9Q083 | |
| MOUSE | 16155 | Il10rb | Interleukin 10 receptor, beta, isoform CRA_b | Q3TU35 |
| MOUSE | 16155 | Il10rb | Interleukin 10 receptor 2 | Q8VHM7 |
| MOUSE | Il10rb | Interleukin-10 receptor subunit beta | Q61190 | |
| RAT | 304091 | Il10rb | Interleukin 10 receptor subunit beta | D3ZM36 |
Protein Classes
PANTHER Classes
protein / receptor / type II cytokine receptor / Interleukin-10 receptor subunit beta
protein / receptor / defense/immunity protein / Interleukin-10 receptor subunit beta
protein / receptor / type I cytokine receptor / Interleukin-10 receptor subunit beta
protein / receptor / type II cytokine receptor / Interleukin-10 receptor subunit beta
protein / receptor / defense/immunity protein / Interleukin-10 receptor subunit beta
protein / receptor / type I cytokine receptor / Interleukin-10 receptor subunit beta
DTO Classes
protein / Receptor / Cytokine receptor / Type II cytokine receptor / Interleukin-10 receptor subunit beta
protein / Receptor / Cytokine receptor / Type II cytokine receptor / Interleukin-10 receptor subunit beta
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx