IL10RB
| Description | Interleukin-10 receptor subunit beta |
|---|
Gene and Protein Information
| Gene ID | 3588 |
|---|---|
| Uniprot Accession IDs | Q9BUU4 IL-10 receptor subunit beta |
| Ensembl ID | ENSP00000290200 |
| Symbol | CRFB4 D21S58 D21S66 CRFB4 CRF2-4 D21S58 D21S66 CDW210B IL-10R2 |
| Family | Belongs to the type II cytokine receptor family. |
| Sequence | MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 473966 | LOC473966 | interleukin-10 receptor subunit beta | 9598 | OMA, EggNOG | |
| Mouse | 16155 | Il10rb | interleukin 10 receptor, beta | 10090 | MGI:109380 | Inparanoid, OMA, EggNOG |
| Rat | 304091 | Il10rb | interleukin 10 receptor subunit beta | 10116 | RGD:1560373 | Inparanoid, OMA, EggNOG |
| Dog | 100856489 | IL10RB | interleukin 10 receptor subunit beta | 9615 | Inparanoid, EggNOG | |
| Horse | 100052549 | IL10RB | interleukin 10 receptor subunit beta | 9796 | OMA, EggNOG | |
| Cow | 767864 | IL10RB | interleukin 10 receptor subunit beta | 9913 | Inparanoid, OMA, EggNOG | |
| Opossum | 100026691 | IL10RB | interleukin 10 receptor subunit beta | 13616 | OMA, EggNOG | |
| Anole lizard | 103281134 | LOC103281134 | interleukin-10 receptor subunit beta | 28377 | OMA, EggNOG | |
| Zebrafish | 797527 | crfb4 | cytokine receptor family member b4 | 7955 | ZDB-GENE-070905-3 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / receptor / type II cytokine receptor / Interleukin-10 receptor subunit beta
protein / receptor / defense/immunity protein / Interleukin-10 receptor subunit beta
protein / receptor / type I cytokine receptor / Interleukin-10 receptor subunit beta
protein / receptor / type II cytokine receptor / Interleukin-10 receptor subunit beta
protein / receptor / defense/immunity protein / Interleukin-10 receptor subunit beta
protein / receptor / type I cytokine receptor / Interleukin-10 receptor subunit beta
DTO Classes
protein / Receptor / Cytokine receptor / Type II cytokine receptor / Interleukin-10 receptor subunit beta
protein / Receptor / Cytokine receptor / Type II cytokine receptor / Interleukin-10 receptor subunit beta
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|