The store will not work correctly when cookies are disabled.
EIF4E2
Description | Eukaryotic translation initiation factor 4E type 2 |
---|
Gene and Protein Information
Gene ID | 9470 |
Uniprot Accession IDs | B8ZZJ9 O75349 eIF-4E type 2 |
Ensembl ID | ENSP00000258416 |
Symbol | EIF4EL3 4EHP IF4e 4E-LP h4EHP EIF4EL3 |
Family | Belongs to the eukaryotic initiation factor 4E family. |
Sequence | MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 460015 | EIF4E2 | eukaryotic translation initiation factor 4E family member 2 | 9598 | VGNC:370 | OMA, EggNOG |
Macaque | 713487 | EIF4E2 | eukaryotic translation initiation factor 4E family member 2 | 9544 | | Inparanoid, OMA |
Mouse | 26987 | Eif4e2 | eukaryotic translation initiation factor 4E member 2 | 10090 | MGI:1914440 | Inparanoid, OMA, EggNOG |
Rat | 363275 | Eif4e2 | eukaryotic translation initiation factor 4E family member 2 | 10116 | RGD:1307790 | Inparanoid, OMA |
Dog | 610238 | EIF4E2 | eukaryotic translation initiation factor 4E family member 2 | 9615 | | Inparanoid, OMA, EggNOG |
Horse | 100057254 | EIF4E2 | eukaryotic translation initiation factor 4E family member 2 | 9796 | VGNC:17504 | Inparanoid, OMA, EggNOG |
Cow | 519920 | EIF4E2 | eukaryotic translation initiation factor 4E family member 2 | 9913 | VGNC:28410 | Inparanoid, OMA, EggNOG |
Pig | 100101924 | EIF4E2 | eukaryotic translation initiation factor 4E family member 2 | 9823 | | Inparanoid, EggNOG |
Opossum | 100011562 | EIF4E2 | eukaryotic translation initiation factor 4E family member 2 | 13616 | | Inparanoid, OMA, EggNOG |
Chicken | 424941 | EIF4E2 | eukaryotic translation initiation factor 4E family member 2 | 9031 | CGNC:52295 | Inparanoid, OMA, EggNOG |
Anole lizard | 100563485 | eif4e2 | eukaryotic translation initiation factor 4E family member 2 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 448677 | mgc89871 | eukaryotic translation initiation factor 4E family member 2 | 8364 | XB-GENE-973579 | Inparanoid, OMA, EggNOG |
Zebrafish | 541523 | eif4e2 | eukaryotic translation initiation factor 4E family member 2 | 7955 | ZDB-GENE-050327-59 | Inparanoid, OMA, EggNOG |
C. elegans | 180464 | ife-4 | Eukaryotic translation initiation factor 4E-4 | 6239 | | Inparanoid, OMA, EggNOG |
Fruitfly | 326255 | 4EHP | eIF4E-Homologous Protein | 7227 | FBgn0053100 | Inparanoid, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|