HINT1

Description	Histidine triad nucleotide-binding protein 1

Gene and Protein Information

Gene ID	3094
Uniprot Accession IDs	Q9H5W8
Ensembl ID	ENSP00000304229
Symbol	HINT PKCI1 PRKCNH1 HINT NMAN PKCI-1 PRKCNH1
Family	Belongs to the HINT family.
Sequence	MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	462040	HINT1	histidine triad nucleotide binding protein 1	9598	VGNC:14159	OMA, EggNOG
Macaque	706083	HINT1	histidine triad nucleotide binding protein 1	9544		Inparanoid, OMA, EggNOG
Mouse	15254	Hint1	histidine triad nucleotide binding protein 1	10090	MGI:1321133	Inparanoid, OMA, EggNOG
Rat		AABR07060778.1	-	10116		OMA, EggNOG
Dog	474667	HINT1	histidine triad nucleotide binding protein 1	9615		Inparanoid, OMA
Horse	100072940	HINT1	histidine triad nucleotide binding protein 1	9796	VGNC:18787	Inparanoid, OMA, EggNOG
Cow	327693	HINT1	histidine triad nucleotide binding protein 1	9913	VGNC:29854	Inparanoid, OMA, EggNOG
Pig	100518898	HINT1	histidine triad nucleotide binding protein 1	9823		OMA, EggNOG
Opossum	100027674	HINT1	histidine triad nucleotide binding protein 1	13616		OMA, EggNOG
Chicken	395424	HINT1Z	histidine triad nucleotide binding protein 1-Z	9031	CGNC:49312	OMA, EggNOG
Anole lizard	100553295	hint1	histidine triad nucleotide binding protein 1	28377		Inparanoid, OMA, EggNOG
Xenopus	548919	hint1	histidine triad nucleotide binding protein 1	8364	XB-GENE-1014427	Inparanoid, OMA, EggNOG
Zebrafish	449551	hint1	histidine triad nucleotide binding protein 1	7955	ZDB-GENE-040927-8	Inparanoid, OMA
C. elegans	184760	hint-1	Histidine triad nucleotide-binding protein 1	6239		Inparanoid, OMA
Fruitfly	33471	CG2862	CG2862 gene product from transcript CG2862-RA	7227	FBgn0031459	Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    Histidine triad nucleotide-binding protein 1
protein    /    nucleotide phosphatase    /    Histidine triad nucleotide-binding protein 1
protein    /    phosphatase    /    Histidine triad nucleotide-binding protein 1

DTO Classes
protein / Enzyme / Hydrolase / Phosphatase / Nucleotide phosphatase / Histidine triad nucleotide-binding protein 1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source