IL20RB
| Description | Interleukin-20 receptor subunit beta |
|---|
Gene and Protein Information
| Gene ID | 53833 |
|---|---|
| Uniprot Accession IDs | B4DL40 Q6P438 Q8IYY5 Q8TAJ7 IL-20 receptor subunit beta |
| Ensembl ID | ENSP00000328133 |
| Symbol | DIRS1 DIRS1 FNDC6 IL-20R2 |
| Family | Belongs to the type II cytokine receptor family. |
| Sequence | MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAFVGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVMSPEELLRAWIS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 742595 | IL20RB | interleukin 20 receptor subunit beta | 9598 | VGNC:1846 | OMA, EggNOG |
| Macaque | 716769 | IL20RB | interleukin 20 receptor subunit beta | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 213208 | Il20rb | interleukin 20 receptor beta | 10090 | MGI:2143266 | Inparanoid, OMA, EggNOG |
| Rat | 501043 | Il20rb | interleukin 20 receptor subunit beta | 10116 | RGD:1566151 | Inparanoid, OMA, EggNOG |
| Dog | 610961 | IL20RB | interleukin 20 receptor subunit beta | 9615 | VGNC:41966 | Inparanoid, OMA, EggNOG |
| Horse | 100066346 | IL20RB | interleukin 20 receptor subunit beta | 9796 | VGNC:19015 | Inparanoid, OMA, EggNOG |
| Cow | 534581 | IL20RB | interleukin 20 receptor subunit beta | 9913 | VGNC:30140 | Inparanoid, OMA, EggNOG |
| Pig | 100620875 | IL20RB | interleukin 20 receptor subunit beta | 9823 | OMA, EggNOG | |
| Opossum | 100024106 | IL20RB | interleukin 20 receptor subunit beta | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 768437 | IL20RB | interleukin 20 receptor subunit beta | 9031 | CGNC:9943 | OMA, EggNOG |
| Anole lizard | 100553073 | il20rb | interleukin 20 receptor subunit beta | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 100174902 | crfb16 | cytokine receptor family member B16 | 7955 | ZDB-GENE-071120-9 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / receptor / type II cytokine receptor / Interleukin-20 receptor subunit beta
protein / receptor / defense/immunity protein / Interleukin-20 receptor subunit beta
protein / receptor / type I cytokine receptor / Interleukin-20 receptor subunit beta
protein / receptor / type II cytokine receptor / Interleukin-20 receptor subunit beta
protein / receptor / defense/immunity protein / Interleukin-20 receptor subunit beta
protein / receptor / type I cytokine receptor / Interleukin-20 receptor subunit beta
DTO Classes
protein / Receptor / Cytokine receptor / Type II cytokine receptor / Interleukin-20 receptor subunit beta
protein / Receptor / Cytokine receptor / Type II cytokine receptor / Interleukin-20 receptor subunit beta
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|