AK1
Description | Adenylate kinase isoenzyme 1 |
---|
Gene and Protein Information
Gene ID | 203 |
---|---|
Uniprot Accession IDs | Q9BVK9 Q9UQC7 AK 1 |
Ensembl ID | ENSP00000362271 |
Symbol | HTL-S-58j |
Family | Belongs to the adenylate kinase family. AK1 subfamily. |
Sequence | MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK |
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
---|---|---|---|---|---|---|
Chimp | 464756 | AK1 | adenylate kinase 1 | 9598 | VGNC:13849 | OMA, EggNOG |
Mouse | 11636 | Ak1 | adenylate kinase 1 | 10090 | MGI:87977 | Inparanoid, OMA, EggNOG |
Dog | 480712 | AK1 | adenylate kinase 1 | 9615 | VGNC:37745 | Inparanoid, OMA, EggNOG |
Horse | 100070413 | AK1 | adenylate kinase 1 | 9796 | VGNC:15194 | Inparanoid, OMA, EggNOG |
Cow | 280715 | AK1 | adenylate kinase 1 | 9913 | VGNC:25770 | Inparanoid, OMA, EggNOG |
Pig | 100521423 | AK1 | adenylate kinase 1 | 9823 | Inparanoid, OMA, EggNOG | |
Opossum | 100011946 | AK1 | adenylate kinase 1 | 13616 | Inparanoid, EggNOG | |
Chicken | 396002 | AK1 | adenylate kinase 1 | 9031 | CGNC:49598 | Inparanoid, OMA |
Anole lizard | 100561285 | ak1 | adenylate kinase 1 | 28377 | OMA, EggNOG | |
Zebrafish | 445486 | ak1 | adenylate kinase 1 | 7955 | ZDB-GENE-040822-37 | Inparanoid, OMA, EggNOG |
C. elegans | 181317 | F38B2.4 | Adenylate kinase isoenzyme 1 | 6239 | Inparanoid, OMA, EggNOG | |
Fruitfly | 39396 | Adk1 | Adenylate kinase 1 | 7227 | FBgn0022709 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleotide kinase / Adenylate kinase isoenzyme 1
protein / transferase / Adenylate kinase isoenzyme 1
protein / kinase / Adenylate kinase isoenzyme 1
protein / nucleotide kinase / Adenylate kinase isoenzyme 1
protein / transferase / Adenylate kinase isoenzyme 1
protein / kinase / Adenylate kinase isoenzyme 1
DTO Classes
protein / Kinase / Non-protein kinase / Nucleotide kinase / Adenylate kinase family / AK1 subfamily / Adenylate kinase isoenzyme 1
protein / Kinase / Non-protein kinase / Nucleotide kinase / Adenylate kinase family / AK1 subfamily / Adenylate kinase isoenzyme 1
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|