Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Adenylate kinase 2, mitochondrial

Gene ID204
uniprotP54819
Gene NameAK2
Ensernbl IDENSP00000346921
FamilyBelongs to the adenylate kinase family. AK2 subfamily.
Sequence
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN204AK2Adenylate kinase 2, mitochondrialP54819
MOUSEAk2Adenylate kinase 2, mitochondrialF7BP55
MOUSE11637Ak2Adenylate kinase 2, mitochondrialQ9WTP6
RAT24184Ak2Adenylate kinase 2, mitochondrialA0A0G2JSG6
RAT24184Ak2Adenylate kinase 2, mitochondrialP29410

Protein Classes

PANTHER Classes
protein    /    nucleotide kinase    /    Adenylate kinase 2, mitochondrial
protein    /    transferase    /    Adenylate kinase 2, mitochondrial
protein    /    kinase    /    Adenylate kinase 2, mitochondrial
DTO Classes
protein    /    Kinase    /    Non-protein kinase    /    Nucleotide kinase    /    Adenylate kinase family    /    AK2 subfamily    /    Adenylate kinase 2, mitochondrial

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source