Protein or Target Summary
Adenylate kinase 2, mitochondrial
Gene ID | 204 |
---|---|
uniprot | P54819 |
Gene Name | AK2 |
Ensernbl ID | ENSP00000346921 |
Family | Belongs to the adenylate kinase family. AK2 subfamily. |
Sequence | MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI Show more |
Gene and Protein Information
Protein Classes
PANTHER Classes
protein / nucleotide kinase / Adenylate kinase 2, mitochondrial
protein / transferase / Adenylate kinase 2, mitochondrial
protein / kinase / Adenylate kinase 2, mitochondrial
protein / nucleotide kinase / Adenylate kinase 2, mitochondrial
protein / transferase / Adenylate kinase 2, mitochondrial
protein / kinase / Adenylate kinase 2, mitochondrial
DTO Classes
protein / Kinase / Non-protein kinase / Nucleotide kinase / Adenylate kinase family / AK2 subfamily / Adenylate kinase 2, mitochondrial
protein / Kinase / Non-protein kinase / Nucleotide kinase / Adenylate kinase family / AK2 subfamily / Adenylate kinase 2, mitochondrial
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx