The store will not work correctly when cookies are disabled.
Protein or Target Summary
Kynurenine--oxoglutarate transaminase 1
Gene ID | 883 |
uniprot | Q16773 |
Gene Name | KYAT1 |
Ensernbl ID | ENSP00000399415 |
Family | Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. |
Sequence | MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 883 | KYAT1 | Kynurenine--oxoglutarate transaminase 1 | Q16773 |
MOUSE | | Kyat1 | Uncharacterized protein | Q8BYH2 |
MOUSE | | Kyat1 | Kynurenine--oxoglutarate transaminase 1 | A2AQY8 |
MOUSE | | Kyat1 | Kynurenine--oxoglutarate transaminase 1 | A2AQY9 |
MOUSE | 70266 | Kyat1 | Ccbl1 protein | Q05CI8 |
MOUSE | 70266 | Kyat1 | Kynurenine--oxoglutarate transaminase 1 | Q8BTY1 |
RAT | 311844 | Kyat1 | Cysteine conjugate-beta lyase 1, isoform CRA_a | G3V827 |
RAT | 311844 | Kyat1 | Kynurenine--oxoglutarate transaminase 1, mitochondrial | Q08415 |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|