The store will not work correctly when cookies are disabled.
MFAP4
| Description | Microfibril-associated glycoprotein 4 |
|---|
Gene and Protein Information
| Gene ID | 4239 |
|---|
| Uniprot Accession IDs | A8KAJ1 A8MVM2 B4E317 Q6P680 |
|---|
| Ensembl ID | ENSP00000378957 |
|---|
| Sequence | MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 710893 | MFAP4 | microfibril associated protein 4 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 76293 | Mfap4 | microfibrillar-associated protein 4 | 10090 | MGI:1342276 | Inparanoid, OMA, EggNOG |
| Dog | 489531 | MFAP4 | microfibril associated protein 4 | 9615 | VGNC:43190 | Inparanoid, OMA, EggNOG |
| Horse | 100073173 | MFAP4 | microfibril associated protein 4 | 9796 | VGNC:20142 | Inparanoid, OMA, EggNOG |
| Cow | 286766 | MFAP4 | microfibril associated protein 4 | 9913 | VGNC:31424 | Inparanoid, OMA, EggNOG |
| Opossum | | MFAP4 | microfibril associated protein 4 [Source:HGNC Symbol;Acc:HGNC:7035] | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562636 | mfap4 | microfibril associated protein 4 | 28377 | | Inparanoid, OMA, EggNOG |
| Zebrafish | 100007488 | LOC100007488 | microfibril-associated glycoprotein 4-like | 7955 | | Inparanoid, OMA |
Protein Classes
DTO Classes protein /
Signaling / Microfibril-associated glycoprotein 4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
