JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Microfibril-associated glycoprotein 4

Gene ID	4239
uniprot	P55083
Gene Name	MFAP4
Ensernbl ID	ENSP00000378957
Sequence	MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	4239	MFAP4	Microfibril-associated glycoprotein 4	P55083
MOUSE	76293	Mfap4	Microfibril-associated glycoprotein 4	Q9D1H9
RAT	287382	Mfap4	Microfibrillar-associated protein 4	Q497C9
RAT		Mfap4	Microfibril-associated protein 4	G3V6A9

Protein Classes

PANTHER Classes
protein / signaling molecule / Microfibril-associated glycoprotein 4

DTO Classes
protein / Signaling / Microfibril-associated glycoprotein 4

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx