The store will not work correctly when cookies are disabled.
MFAP5
| Description | Microfibrillar-associated protein 5 |
|---|
Gene and Protein Information
| Gene ID | 8076 |
|---|
| Uniprot Accession IDs | B0AZL6 D3DUV1 Q7Z490 MFAP-5 |
|---|
| Ensembl ID | ENSP00000352455 |
|---|
| Symbol | MAGP2 AAT9 MP25 MAGP2 MAGP-2 MFAP-5 |
|---|
| Family | Belongs to the MFAP family. |
|---|
| Sequence | MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 473403 | MFAP5 | microfibril associated protein 5 | 9598 | VGNC:5474 | OMA, EggNOG |
| Macaque | 716459 | MFAP5 | microfibril associated protein 5 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 50530 | Mfap5 | microfibrillar associated protein 5 | 10090 | MGI:1354387 | Inparanoid, OMA, EggNOG |
| Rat | 362429 | Mfap5 | microfibril associated protein 5 | 10116 | RGD:1307919 | Inparanoid, OMA, EggNOG |
| Dog | 477701 | MFAP5 | microfibril associated protein 5 | 9615 | VGNC:43191 | Inparanoid, OMA, EggNOG |
| Cow | 281908 | MFAP5 | microfibril associated protein 5 | 9913 | VGNC:31425 | Inparanoid, OMA, EggNOG |
| Pig | 100512231 | MFAP5 | microfibril associated protein 5 | 9823 | | Inparanoid, EggNOG |
| Opossum | 100013862 | MFAP5 | microfibril associated protein 5 | 13616 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
