The store will not work correctly when cookies are disabled.
Protein or Target Summary
Microfibrillar-associated protein 5
| Gene ID | 8076 |
|---|
| uniprot | Q13361 |
|---|
| Gene Name | MFAP5 |
|---|
| Ensernbl ID | ENSP00000352455 |
|---|
| Family | Belongs to the MFAP family. |
|---|
| Sequence | MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 8076 | MFAP5 | Microfibrillar-associated protein 5 | Q13361 |
| MOUSE | | Mfap5 | Microfibrillar-associated protein 5 | D3Z4D7 |
| MOUSE | | Mfap5 | Microfibrillar-associated protein 5 | D3Z3L7 |
| MOUSE | | Mfap5 | Microfibrillar-associated protein 5 | D3YW93 |
| MOUSE | | Mfap5 | Microfibrillar-associated protein 5 | D3Z0U1 |
| MOUSE | 50530 | Mfap5 | Microfibrillar-associated protein 5 | F8WJ99 |
| MOUSE | 50530 | Mfap5 | Microfibrillar-associated protein 5 | Q9QZJ6 |
| RAT | 362429 | Mfap5 | Microfibril-associated protein 5 | D3ZJB1 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
