Protein or Target Summary
Cytokine receptor common subunit gamma
| Gene ID | 3561 |
|---|---|
| uniprot | P31785 |
| Gene Name | IL2RG |
| Ensernbl ID | ENSP00000363318 |
| Family | Belongs to the type I cytokine receptor family. Type 5 subfamily. |
| Sequence | MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 3561 | IL2RG | Cytokine receptor common subunit gamma | P31785 |
| MOUSE | 16186 | Il2rg | Common cytokine receptor gamma chain variant b | V5SIM2 |
| MOUSE | Il2rg | Cytokine receptor common subunit gamma | B0QZX1 | |
| MOUSE | 16186 | Il2rg | Interleukin 2 receptor, gamma chain, isoform CRA_b | Q3UPA9 |
| MOUSE | 16186 | Il2rg | Cytokine receptor common subunit gamma | P34902 |
| RAT | 140924 | Il2rg | Interleukin 2 receptor subunit gamma | Q68FU6 |
| RAT | Il2rg | Cytokine receptor gamma chain | Q8VHR8 | |
| RAT | Il2rg | Interleukin 2 receptor subunit gamma | A0A096MKA3 | |
| RAT | Il2rg | IL2RG | D3JTH6 | |
| RAT | Il2rg | IL2RG | D3JTH7 | |
| RAT | Il2rg | IL2RG | D3JTI0 | |
| RAT | Il2rg | Ab2-183 | Q7TP53 | |
| RAT | Il2rg | IL2RG | D3JTH8 |
Protein Classes
PANTHER Classes
protein / signaling molecule / defense/immunity protein / Cytokine receptor common subunit gamma
protein / signaling molecule / cytokine / Cytokine receptor common subunit gamma
protein / signaling molecule / defense/immunity protein / Cytokine receptor common subunit gamma
protein / signaling molecule / cytokine / Cytokine receptor common subunit gamma
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx