MELK

Description	Maternal embryonic leucine zipper kinase

Gene and Protein Information

Gene ID	9833
Uniprot Accession IDs	A6P3A7 A6P3A8 B1AMQ6 B7Z1E6 B7Z5M5 B7Z6Q7 B7Z6R8 B7Z6Y0 B7Z7Q1 D3DRP8 F5H0Y0 F5H2R4 F5H689 Q7L3C3 hMELK
Ensembl ID	ENSP00000298048
Symbol	KIAA0175 HPK38
Family	Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.
Sequence	MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	465095	MELK	maternal embryonic leucine zipper kinase	9598	VGNC:4782	OMA, EggNOG
Macaque	716875	MELK	maternal embryonic leucine zipper kinase	9544		Inparanoid, OMA, EggNOG
Mouse	17279	Melk	maternal embryonic leucine zipper kinase	10090	MGI:106924	Inparanoid, OMA, EggNOG
Dog	481608	MELK	maternal embryonic leucine zipper kinase	9615	VGNC:51744	Inparanoid, OMA, EggNOG
Horse	100055291	MELK	maternal embryonic leucine zipper kinase	9796	VGNC:49328	Inparanoid, OMA, EggNOG
Cow	520088	MELK	maternal embryonic leucine zipper kinase	9913	VGNC:50031	Inparanoid, OMA, EggNOG
Pig	100519998	MELK	maternal embryonic leucine zipper kinase	9823		Inparanoid, OMA, EggNOG
Opossum	100018004	MELK	maternal embryonic leucine zipper kinase	13616		Inparanoid, OMA, EggNOG
Platypus	100078125	MELK	maternal embryonic leucine zipper kinase	9258		Inparanoid, OMA, EggNOG
Chicken	428391	MELK	maternal embryonic leucine zipper kinase	9031	CGNC:12305	OMA, EggNOG
Anole lizard	100555349	melk	maternal embryonic leucine zipper kinase	28377		Inparanoid, OMA, EggNOG
Xenopus	549144	melk	maternal embryonic leucine zipper kinase	8364	XB-GENE-987654	Inparanoid, OMA, EggNOG
Zebrafish	30724	melk	maternal embryonic leucine zipper kinase	7955	ZDB-GENE-990603-5	Inparanoid, OMA
C. elegans	176877	pig-1	Maternal embryonic leucine zipper kinase	6239		Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    non-receptor serine/threonine protein kinase    /    Maternal embryonic leucine zipper kinase
protein    /    protein kinase    /    Maternal embryonic leucine zipper kinase
protein    /    transferase    /    Maternal embryonic leucine zipper kinase
protein    /    kinase    /    Maternal embryonic leucine zipper kinase

DTO Classes
protein / Kinase / Protein kinase / CAMK group / CAMKL family / MELK subfamily / Maternal embryonic leucine zipper kinase

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]