| Description | Maternal embryonic leucine zipper kinase |
|---|
Gene and Protein Information
| Gene ID | 9833 |
|---|---|
| Uniprot Accession IDs | A6P3A7 A6P3A8 B1AMQ6 B7Z1E6 B7Z5M5 B7Z6Q7 B7Z6R8 B7Z6Y0 B7Z7Q1 D3DRP8 F5H0Y0 F5H2R4 F5H689 Q7L3C3 hMELK |
| Ensembl ID | ENSP00000298048 |
| Symbol | KIAA0175 HPK38 |
| Family | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily. |
| Sequence | MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 465095 | MELK | maternal embryonic leucine zipper kinase | 9598 | VGNC:4782 | OMA, EggNOG |
| Macaque | 716875 | MELK | maternal embryonic leucine zipper kinase | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 17279 | Melk | maternal embryonic leucine zipper kinase | 10090 | MGI:106924 | Inparanoid, OMA, EggNOG |
| Dog | 481608 | MELK | maternal embryonic leucine zipper kinase | 9615 | VGNC:51744 | Inparanoid, OMA, EggNOG |
| Horse | 100055291 | MELK | maternal embryonic leucine zipper kinase | 9796 | VGNC:49328 | Inparanoid, OMA, EggNOG |
| Cow | 520088 | MELK | maternal embryonic leucine zipper kinase | 9913 | VGNC:50031 | Inparanoid, OMA, EggNOG |
| Pig | 100519998 | MELK | maternal embryonic leucine zipper kinase | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100018004 | MELK | maternal embryonic leucine zipper kinase | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100078125 | MELK | maternal embryonic leucine zipper kinase | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 428391 | MELK | maternal embryonic leucine zipper kinase | 9031 | CGNC:12305 | OMA, EggNOG |
| Anole lizard | 100555349 | melk | maternal embryonic leucine zipper kinase | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549144 | melk | maternal embryonic leucine zipper kinase | 8364 | XB-GENE-987654 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30724 | melk | maternal embryonic leucine zipper kinase | 7955 | ZDB-GENE-990603-5 | Inparanoid, OMA |
| C. elegans | 176877 | pig-1 | Maternal embryonic leucine zipper kinase | 6239 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Maternal embryonic leucine zipper kinase
protein / protein kinase / Maternal embryonic leucine zipper kinase
protein / transferase / Maternal embryonic leucine zipper kinase
protein / kinase / Maternal embryonic leucine zipper kinase
protein / non-receptor serine/threonine protein kinase / Maternal embryonic leucine zipper kinase
protein / protein kinase / Maternal embryonic leucine zipper kinase
protein / transferase / Maternal embryonic leucine zipper kinase
protein / kinase / Maternal embryonic leucine zipper kinase
DTO Classes
protein / Kinase / Protein kinase / CAMK group / CAMKL family / MELK subfamily / Maternal embryonic leucine zipper kinase
protein / Kinase / Protein kinase / CAMK group / CAMKL family / MELK subfamily / Maternal embryonic leucine zipper kinase
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|