The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
CFL1
Gene and Protein Information
| Gene ID | 1072 |
|---|
| Uniprot Accession IDs | P23528 B3KUQ1 Q53Y87 Q9UCA2 |
|---|
| Ensembl ID | ENSP00000432660 |
|---|
| Symbol | CFL CFL cofilin HEL-S-15 |
|---|
| Family | Belongs to the actin-binding proteins ADF family. |
|---|
| Sequence | MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 745772 | CFL1 | cofilin 1 | 9598 | VGNC:6759 | OMA, EggNOG |
| Macaque | 721882 | CFL1 | cofilin 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 12631 | Cfl1 | cofilin 1, non-muscle | 10090 | MGI:101757 | Inparanoid, OMA, EggNOG |
| Rat | 29271 | Cfl1 | cofilin 1 | 10116 | RGD:69285 | Inparanoid, OMA, EggNOG |
| Dog | 476022 | CFL1 | cofilin 1 | 9615 | | Inparanoid, OMA, EggNOG |
| Horse | 100057603 | CFL1 | cofilin 1 | 9796 | VGNC:16464 | Inparanoid, OMA, EggNOG |
| Cow | 534553 | CFL1 | cofilin 1 | 9913 | VGNC:27253 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
The page will load shortly, Thanks for your patience!
