The store will not work correctly when cookies are disabled.
CFL1
Gene and Protein Information
| Gene ID | 1072 |
|---|
| Uniprot Accession IDs | B3KUQ1 Q53Y87 Q9UCA2 |
|---|
| Ensembl ID | ENSP00000432660 |
|---|
| Symbol | CFL CFL cofilin HEL-S-15 |
|---|
| Family | Belongs to the actin-binding proteins ADF family. |
|---|
| Sequence | MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 745772 | CFL1 | cofilin 1 | 9598 | VGNC:6759 | OMA, EggNOG |
| Macaque | 721882 | CFL1 | cofilin 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 12631 | Cfl1 | cofilin 1, non-muscle | 10090 | MGI:101757 | Inparanoid, OMA, EggNOG |
| Rat | 29271 | Cfl1 | cofilin 1 | 10116 | RGD:69285 | Inparanoid, OMA, EggNOG |
| Dog | 476022 | CFL1 | cofilin 1 | 9615 | | Inparanoid, OMA, EggNOG |
| Horse | 100057603 | CFL1 | cofilin 1 | 9796 | VGNC:16464 | Inparanoid, OMA, EggNOG |
| Cow | 534553 | CFL1 | cofilin 1 | 9913 | VGNC:27253 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
