The store will not work correctly when cookies are disabled.
METTL14
| Description | N6-adenosine-methyltransferase non-catalytic subunit |
|---|
Gene and Protein Information
| Gene ID | 57721 |
|---|
| Uniprot Accession IDs | A6NIG1 Q969V2 |
|---|
| Ensembl ID | ENSP00000373474 |
|---|
| Symbol | KIAA1627 hMETTL14 |
|---|
| Family | Belongs to the MT-A70-like family. |
|---|
| Sequence | MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 461454 | METTL14 | methyltransferase like 14 | 9598 | VGNC:633 | OMA, EggNOG |
| Macaque | 704667 | METTL14 | methyltransferase like 14 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 210529 | Mettl14 | methyltransferase like 14 | 10090 | MGI:2442926 | Inparanoid, OMA, EggNOG |
| Rat | 295428 | Mettl14 | methyltransferase like 14 | 10116 | RGD:1304822 | Inparanoid, OMA, EggNOG |
| Dog | 487920 | METTL14 | methyltransferase like 14 | 9615 | VGNC:43171 | Inparanoid, OMA, EggNOG |
| Horse | 100072440 | METTL14 | methyltransferase like 14 | 9796 | VGNC:20120 | Inparanoid, OMA, EggNOG |
| Cow | 531382 | METTL14 | methyltransferase like 14 | 9913 | VGNC:31404 | Inparanoid, OMA, EggNOG |
| Pig | 100525761 | METTL14 | methyltransferase like 14 | 9823 | | OMA, EggNOG |
| Opossum | 100012069 | METTL14 | methyltransferase like 14 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100081630 | METTL14 | methyltransferase like 14 | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 422684 | METTL14 | methyltransferase like 14 | 9031 | CGNC:51803 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567789 | mettl14 | methyltransferase like 14 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 493301 | mettl14 | methyltransferase like 14 | 8364 | XB-GENE-5813560 | Inparanoid, OMA, EggNOG |
| Zebrafish | 404603 | mettl14 | methyltransferase like 14 | 7955 | ZDB-GENE-040426-2328 | Inparanoid, OMA, EggNOG |
| Fruitfly | 34138 | CG7818 | CG7818 gene product from transcript CG7818-RA | 7227 | FBgn0032016 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 850303 | KAR4 | Kar4p | 4932 | S000000560 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes protein /
transcription factor / N6-adenosine-methyltransferase non-catalytic subunit
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
