Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

PRKACG

DescriptioncAMP-dependent protein kinase catalytic subunit gamma

Gene and Protein Information

Gene ID5568
Uniprot Accession IDs O60850 Q5VZ02 Q86YI1 PKA C-gamma
Ensembl ID ENSP00000366488
Symbol KAPG PKACg BDPLT19
FamilyBelongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.
Sequence
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp472944PRKACGprotein kinase cAMP-activated catalytic subunit gamma9598VGNC:13947OMA, EggNOG
Macaque700652PRKACGprotein kinase cAMP-activated catalytic subunit gamma9544OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Kinase    /    Protein kinase    /    AGC group    /    PKA family    /    Camp-dependent protein kinase catalytic subunit gamma

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      Bleeding disorder, platelet-type 190UniProt Disease
      Bleeding Disorder, Platelet-Type, 191MonarchMONDO:0014518
      BLEEDING DISORDER, PLATELET-TYPE, 191CTDMONDO:0014518
      BLEEDING DISORDER, PLATELET-TYPE, 191DisGeNETMONDO:0014518

      Bibliography

      1.Bodnar, Richard J RJ, Xi, Xiaodong X, Li, Zhenyu Z, Berndt, Michael C MC and Du, Xiaoping X. 2002-12-06 Regulation of glycoprotein Ib-IX-von Willebrand factor interaction by cAMP-dependent protein kinase-mediated phosphorylation at Ser 166 of glycoprotein Ib(beta). [PMID:12361948]
      2.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      3.Jiang, Guoqiang G and Zhang, Bei B BB. 2003-04 Glucagon and regulation of glucose metabolism. [PMID:12626323]
      4.Vermeulen, Linda L, De Wilde, Gert G, Van Damme, Petra P, Vanden Berghe, Wim W and Haegeman, Guy G. 2003-03-17 Transcriptional activation of the NF-kappaB p65 subunit by mitogen- and stress-activated protein kinase-1 (MSK1). [PMID:12628924]
      5. and Veech, Richard L RL. 2003-05-13 A humble hexose monophosphate pathway metabolite regulates short- and long-term control of lipogenesis. [PMID:12721358]
      6.Cartier, Christine C and 6 more authors. 2003-09-12 Active cAMP-dependent protein kinase incorporated within highly purified HIV-1 particles is required for viral infectivity and interacts with viral capsid protein. [PMID:12842892]
      7.Foss, K B KB and 8 more authors. 1992 Localization of the catalytic subunit C gamma of the cAMP-dependent protein kinase gene (PRKACG) to human chromosome region 9q13. [PMID:1339328]
      8.Zhang, Weiqing W, Morris, Gary Z GZ and Beebe, Stephen J SJ. 2004-05 Characterization of the cAMP-dependent protein kinase catalytic subunit Cgamma expressed and purified from sf9 cells. [PMID:15039079]
      9.Gerhard, Daniela S DS and 115 more authors. 2004-10 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [PMID:15489334]
      10.Schultess, Jan J, Danielewski, Oliver O and Smolenski, Albert P AP. 2005-04-15 Rap1GAP2 is a new GTPase-activating protein of Rap1 expressed in human platelets. [PMID:15632203]