The store will not work correctly when cookies are disabled.
PRKACG
| Description | cAMP-dependent protein kinase catalytic subunit gamma |
|---|
Gene and Protein Information
| Gene ID | 5568 |
|---|
| Uniprot Accession IDs | O60850 Q5VZ02 Q86YI1 PKA C-gamma |
|---|
| Ensembl ID | ENSP00000366488 |
|---|
| Symbol | KAPG PKACg BDPLT19 |
|---|
| Family | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily. |
|---|
| Sequence | MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 472944 | PRKACG | protein kinase cAMP-activated catalytic subunit gamma | 9598 | VGNC:13947 | OMA, EggNOG |
| Macaque | 700652 | PRKACG | protein kinase cAMP-activated catalytic subunit gamma | 9544 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
