The store will not work correctly when cookies are disabled.
DDIT3
| Description | DDIT3 upstream open reading frame protein |
|---|
Gene and Protein Information
| Gene ID | 1649 |
|---|
| Uniprot Accession IDs | P0DPQ6 |
|---|
| Ensembl ID | ENSP00000448665 |
|---|
| Symbol | CHOP CEBPZ CHOP10 CHOP-10 GADD153 AltDDIT3 C/EBPzeta |
|---|
| Sequence | MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 452017 | DDIT3 | DNA damage inducible transcript 3 | 9598 | VGNC:12914 | OMA, EggNOG |
| Macaque | 714901 | DDIT3 | DNA damage inducible transcript 3 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 13198 | Ddit3 | DNA-damage inducible transcript 3 | 10090 | MGI:109247 | Inparanoid, OMA, EggNOG |
| Rat | 29467 | Ddit3 | DNA-damage inducible transcript 3 | 10116 | RGD:62391 | Inparanoid, OMA, EggNOG |
| Dog | 607439 | DDIT3 | DNA damage inducible transcript 3 | 9615 | VGNC:39836 | Inparanoid, OMA, EggNOG |
| Horse | 100053417 | DDIT3 | DNA damage inducible transcript 3 | 9796 | VGNC:17075 | Inparanoid, OMA, EggNOG |
| Cow | 777788 | DDIT3 | DNA damage inducible transcript 3 | 9913 | VGNC:27947 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567470 | ddit3 | DNA damage inducible transcript 3 | 28377 | | Inparanoid, OMA |
| Xenopus | 733816 | ddit3 | DNA damage inducible transcript 3 | 8364 | XB-GENE-1011286 | Inparanoid, OMA, EggNOG |
| Zebrafish | 561924 | ddit3 | DNA-damage-inducible transcript 3 | 7955 | ZDB-GENE-070410-90 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
