The store will not work correctly when cookies are disabled.
Protein or Target Summary
DDIT3 upstream open reading frame protein
| Gene ID | 1649 |
|---|
| uniprot | P0DPQ6 |
|---|
| Gene Name | DDIT3 |
|---|
| Ensernbl ID | ENSP00000448665 |
|---|
| Sequence | MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 1649 | DDIT3 | DDIT3 upstream open reading frame protein | P0DPQ6 |
| MOUSE | 13198 | Ddit3 | DNA damage-inducible transcript 3 protein | P35639 |
| MOUSE | 13198 | Ddit3 | DNA damage-inducible transcript 3 protein | Q3V405 |
| MOUSE | | Ddit3 | DNA damage-inducible transcript 3 protein | D3YX14 |
| MOUSE | | Ddit3 | DNA damage-inducible transcript 3 protein | A0A2R8VHR8 |
| RAT | | Ddit3 | DNA damage-inducible transcript 3 protein | Q62857 |
| RAT | 29467 | Ddit3 | DNA damage-inducible transcript 3 protein | Q496Y7 |
| RAT | 29467 | Ddit3 | DNA damage-inducible transcript 3 protein | Q62804 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
