| Description | Transcription factor AP-1 |
|---|
Gene and Protein Information
| Gene ID | 3725 |
|---|---|
| Uniprot Accession IDs | Q6FHM7 Q96G93 |
| Ensembl ID | ENSP00000360266 |
| Symbol | AP1 p39 AP-1 c-Jun |
| Family | Belongs to the bZIP family. Jun subfamily. |
| Sequence | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 16476 | Jun | jun proto-oncogene | 10090 | MGI:96646 | Inparanoid, OMA |
| Rat | 24516 | Jun | Jun proto-oncogene, AP-1 transcription factor subunit | 10116 | RGD:2943 | Inparanoid, OMA, EggNOG |
| Dog | 609429 | JUN | Jun proto-oncogene, AP-1 transcription factor subunit | 9615 | VGNC:42197 | Inparanoid, OMA, EggNOG |
| Cow | 280831 | JUN | Jun proto-oncogene, AP-1 transcription factor subunit | 9913 | VGNC:30386 | Inparanoid, OMA, EggNOG |
| Opossum | 100018774 | JUN | Jun proto-oncogene, AP-1 transcription factor subunit | 13616 | Inparanoid, OMA | |
| Chicken | 424673 | JUN | Jun proto-oncogene, AP-1 transcription factor subunit | 9031 | CGNC:52234 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567718 | jun | Jun proto-oncogene, AP-1 transcription factor subunit | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100493911 | jun | jun proto-oncogene | 8364 | XB-GENE-482228 | Inparanoid, OMA, EggNOG |
| Zebrafish | 335916 | jun | Jun proto-oncogene, AP-1 transcription factor subunit | 7955 | ZDB-GENE-030131-7859 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transcription factor / basic leucine zipper transcription factor / Transcription factor AP-1
protein / transcription factor / nucleic acid binding / Transcription factor AP-1
protein / transcription factor / basic leucine zipper transcription factor / Transcription factor AP-1
protein / transcription factor / nucleic acid binding / Transcription factor AP-1
DTO Classes
protein / Transcription factor / Basic leucine zipper transcription factor / Transcription factor AP-1
protein / Transcription factor / Basic leucine zipper transcription factor / Transcription factor AP-1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|