Protein or Target Summary
12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
| Gene ID | 2853 |
|---|---|
| uniprot | O00270 |
| Gene Name | GPR31 |
| Ensernbl ID | ENSP00000355799 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFLAAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS Show more |
Gene and Protein Information
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
protein / G-protein coupled receptor / Class A rhodopsin like / 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx