JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

GPR32

Description	Probable G-protein coupled receptor 32

Gene and Protein Information

Gene ID	2854
Uniprot Accession IDs	Q502U7 Q6NWS5
Ensembl ID	ENSP00000270590
Symbol	RVDR1
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMYYIVSRQWLLGEWACKLYITFVFLSYFASNCLLVFISVDRCISVLYPVWALNHRTVQRASWLAFGVWLLAAALCSAHLKFRTTRKWNGCTHCYLAFNSDNETAQIWIEGVVEGHIIGTIGHFLLGFLGPLAIIGTCAHLIRAKLLREGWVHANRPKRLLLVLVSAFFIFWSPFNVVLLVHLWRRVMLKEIYHPRMLLILQASFALGCVNSSLNPFLYVFVGRDFQEKFFQSLTSALARAFGEEEFLSSCPRGNAPRE Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	748574	GPR32	G protein-coupled receptor 32	9598	VGNC:11123	OMA, EggNOG
Pig		GPR32	G protein-coupled receptor 32 [Source:HGNC Symbol;Acc:HGNC:4487]	9823		OMA, EggNOG

PANTHER Classes
protein / receptor / G-protein coupled receptor / Probable G-protein coupled receptor 32

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Probable G-protein coupled receptor 32

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source